Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SGSGSGLP2.7.11.30;Receptor protein serine/threonine kinase. 186
  • Domain: GS
PLLVQRTIA2.7.11.30;Receptor protein serine/threonine kinase. 193
  • Domain: GS
RHENILGFIAAD2.7.11.30;Receptor protein serine/threonine kinase. 254
  • Domain: Protein kinase
LITDYHE2.7.11.30;Receptor protein serine/threonine kinase. 277
  • Domain: Protein kinase
KPAIAHRD2.7.11.30;Receptor protein serine/threonine kinase. 325
  • Domain: Protein kinase
HRDLKSKNILVKKNG2.7.11.30;Receptor protein serine/threonine kinase. 330
  • Active Site D=Aspartic acid at location 332 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
CCIADLGLA2.7.11.30;Receptor protein serine/threonine kinase. 346
  • Domain: Protein kinase
IADLGLA2.7.11;Protein-serine/threonine kinases. 348
  • Domain: Protein kinase
RVGTKRYM2.7.11.30;Receptor protein serine/threonine kinase. 371
  • Domain: Protein kinase
ECWAHNPASRLTALR2.7.11.30;Receptor protein serine/threonine kinase. 472
  • Domain: Protein kinase
RLTALRVKKT2.7.11.30;Receptor protein serine/threonine kinase. 481
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERN
ECNKDLHPTLPPLKNRDFVDGPIHHRALLISVTVCSLLLVLIILFCYFRYKRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQS
SGSGSGLPLLVQRTI
A
KQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQG
KPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADM
YSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMT
ECWAHNPASRLTALRVKKTLAKMSESQDI
KL



DME EC Prediction for this protein is: 2.7.11.30
Check another protein