Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PRWVVPVLP3.1.2.15;Ubiquitin thiolesterase. 83 -
PFGQCYE3.1.2.15;Ubiquitin thiolesterase. 259 -
FRLKMILRLLQ3.1.2.15;Ubiquitin thiolesterase. 335 -
DSLHQPQYVEKLEKI3.1.2.15;Ubiquitin thiolesterase. 403 -
AQAGKHEAIVKNVHDLLAKLAWDF3.1.2.15;Ubiquitin thiolesterase. 438 -
LLELIRRLAEDDK3.1.2.15;Ubiquitin thiolesterase. 488 -
KILDYSCSQ3.1.2.15;Ubiquitin thiolesterase. 535 -
FLLKDGQLWLCA3.1.2.15;Ubiquitin thiolesterase. 664 -
INKDFFE3.1.2.15;Ubiquitin thiolesterase. 716 -
KCFERFFKAVN3.1.2.15;Ubiquitin thiolesterase. 739 -
GLKNAGATCYMNSV3.1.2.15;Ubiquitin thiolesterase. 1560
  • Active Site C=Cysteine at location 1568 on the protein
  • Active Site Description: By similarity.
IQQLYMIP3.1.2.15;Ubiquitin thiolesterase. 1574 -
GEPVNLREQ3.1.2.15;Ubiquitin thiolesterase. 1677 -
CAIKFNDYFEFPR3.1.2.15;Ubiquitin thiolesterase. 1810 -
YRRQKRWWNAY3.1.2.15;Ubiquitin thiolesterase. 1941 -
HYQKRAYQ3.1.2.15;Ubiquitin thiolesterase. 2380 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTAITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQHEDEEPAFPHTELANLDDMINRPRWVVPVLPKGELEVLLE
AAIDLSVKGLDVKSEACQRFFRDGLTISFTKILMDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNPHCKFHIYNGTRPCELISSN
AQLPEDELFARSSDPRSPKGWLVDLINKFGTLNGFQILHDRFFNGSALNIQIIAALIK
PFGQCYEFLSQHTLKKYFIPVIEIVPHLLENLTDEELKKEAK
NEAKNDALSMIIKSLKNLASRISGQDETIKNLEI
FRLKMILRLLQISSFNGKMNALNEINKVISSVSYYTHRHSNPEEEEWLTAERMAEWIQQNNILSIV
LQ
DSLHQPQYVEKLEKILRFVIKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPGQLDHLFDCFKASWTNASKKQREKLLELIRRLAEDDK
DGVMAHKVLNLLWNLAQSDDVPVDIMDLALSAHIKILDYSCSQDRDAQKIQWIDHFIEELRTNDKWVIPALKQIREICSLFGEASQNLSQTQRSPHIFYR
HDLINQLQQNHALVTLVAENLATYMNSIRLYAGDHEDYDPQTVRLGSRYSHVQEVQERLNFLR
FLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFK
WYSKLMGDEPDLDPD
INKDFFESNVLQLDPSLLTENGMKCFERFFKAVNCRERKLIAKRRSYMMDDLELIGLDYLWRVVIQSSDEIANRAIDLLKEIYTN
LGPRLKANQVVIHEDFIQSCFDRLKASYDTLCVFDGDKNSINCARQEAIRMVRVLTVIKEYINECDSDYHKERMILPMSRAFRGKHLSLIVRFPNQGRQV
DELDIWSHTNDTIGSVRRCIVNRIKANVAHKKIELFVGGELIDSEDDRKLIGQLNLKDKSLITAKLTQINFNMPSSPDSSSDSSTASPGNHRNHYNDGPN
LEVESCLPGVIMSVHPRYISFLWQVADLGSNLNMPPLRDGARVLMKLMPPDRTAVEKLRAVCLDHAKLGEGKLSPPLDSLFFGPSASQVLYLTEVVYALL
MPAGVPLTDGSSDFQVHFLKSGGLPLVLSMLIRNNFLPNTDMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPVVDGTDPITQINQVTHDQAVVLQ
SALQSIPNPSSECVLRNESILLAQEISNEASRYMPDICVIRAIQKIIWASACGALGLVFSPNEEITKIYQMTTNGSNKLEVEDEQVCCEALEVMTLCFAL
LPTALDALSKEKAWQTFIIDLLLHCPSKTVRQLAQEQFFLMCTRCCMGHRPLLFFITLLFTILGSTAREKGKYSGDYFTLLRHLLNYAYNGNINIPNAEV
LLVSEIDWLKRIRDNVKNTGETGVEEPILEGHLGVTKELLAFQTSEKKYHFGCEKGGANLIKELIDDFIFPASKVYLQYLRSGELPAEQAIPVCSSPVTI
NAGFELLVALAIGCVRNLKQIVDCLTEMYYMGTAITTCEALTEWEYLPPVGPRPPKGFV
GLKNAGATCYMNSVIQQLYMIPSIRNSILAIEGTGSDLHDD
MFGDEKQDSESNVDPRDDVFGYPHQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASQLQYYVPRGFWKQFRLW
GEPVNLREQHDALEFFNSLVDSLD
EALKALGHPAILSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNHQNLLDSLEQYIKGDLLEGANAYHCEKCDKKVDTVKRLLIKKLPRVLAIQLK
RFDYDWERE
CAIKFNDYFEFPRELDMGPYTVAGVANLERDNVNSENELIEQKEQSDNETAGGTKYRLVGVLVHSGQASGGHYYSYIIQRNGKDDQTDHWY
KFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFDHMMKRMS
YRRQKRWWNAYILFYEQMDMIDEDDEMIRYISELTIARPHQIIMSPAIERSVRKQNVKFM
HNRLQYSLEYFQFVKKLLTCNGVYLNPAPGQDYLLPEAEEITMISIQLAARFLFTTGFHTKKIVRGPASDWYDALCVLLRHSKNVRFWFTHNVLFNVSNR
FSEYLLECPSAEVRGAFAKLIVFIAHFSLQDGSCPSPFASPGPSSQACDNLSLSDHLLRATLNLLRREVSEHGHHLQQYFNLFVMYANLGVAEKTQLLKL
NVPATFMLVSLDEGPGPPIKYQYAELGKLYSVVSQLIRCCNVSSTMQSSINGNPPLPNPFGDLNLSQPIMPIQQNVLDILFVRTSYVKKIIEDCSNSEDT
IKLLRFCSWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLFQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKN
HYQKRAYQCIKCMVALFSSCP
VAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYSYNNWSPPVQSNETANGYFLERSHSARMTLAKACELCPEEEPDDQDAPDEHEPSPSEDAPLY
PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ



DME EC Prediction for this protein is: 3.1.2.15
Check another protein