Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KCSYSPEPDQ3.4.14.9;Tripeptidyl-peptidase I. 18
  • Gene: TPP1
EEELSLTFALRQQNVERLS3.4.14.9;Tripeptidyl-peptidase I. 44
  • Gene: TPP1
LVQAVSDP3.4.14.9;Tripeptidyl-peptidase I. 64
  • Gene: TPP1
YGKYLTLE3.4.14.9;Tripeptidyl-peptidase I. 76
  • Gene: TPP1
TQDFLTCWLS3.4.14.9;Tripeptidyl-peptidase I. 116
  • Gene: TPP1
RQAELLLPGAEFH3.4.14.9;Tripeptidyl-peptidase I. 127
  • Gene: TPP1
GAEFHHYVGGP3.4.14.9;Tripeptidyl-peptidase I. 135
  • Gene: TPP1
GLHRFPP3.4.14.9;Tripeptidyl-peptidase I. 172
  • Gene: TPP1
RQRPEPQ3.4.14.9;Tripeptidyl-peptidase I. 183
  • Gene: TPP1
LHLGVTPSV3.4.14.9;Tripeptidyl-peptidase I. 196
  • Gene: TPP1
NNSQACAQFLEQYFH3.4.14.9;Tripeptidyl-peptidase I. 222
  • Gene: TPP1
QGRGRAGIEASLDV3.4.14.9;Tripeptidyl-peptidase I. 264
  • Active Site E=Glutamic acid at location 272 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: TPP1
YLMSAGANISTWVYSSPGRHE3.4.14.9;Tripeptidyl-peptidase I. 279
  • Gene: TPP1
QEPFLQWL3.4.14.9;Tripeptidyl-peptidase I. 301
  • Gene: TPP1
LLSNESALP3.4.14.9;Tripeptidyl-peptidase I. 310
  • Gene: TPP1
VHTVSYGDDEDSLSS3.4.14.9;Tripeptidyl-peptidase I. 320
  • Gene: TPP1
YIQRVNTE3.4.14.9;Tripeptidyl-peptidase I. 336
  • Gene: TPP1
MKAAARGLTLLFASGD3.4.14.9;Tripeptidyl-peptidase I. 345
  • Gene: TPP1
GAGCWSVSGRH3.4.14.9;Tripeptidyl-peptidase I. 362
  • Gene: TPP1
FPASSPYVTTVGGTSF3.4.14.9;Tripeptidyl-peptidase I. 378
  • Gene: TPP1
VDYISGGGFSNVFP3.4.14.9;Tripeptidyl-peptidase I. 404
  • Gene: TPP1
PSYQEEAV3.4.14.9;Tripeptidyl-peptidase I. 419
  • Gene: TPP1
YFNASGRAYPDVAALSDGYWVVSN3.4.14.9;Tripeptidyl-peptidase I. 441
  • Gene: TPP1
VPIPWVSGTSASTPVFGG3.4.14.9;Tripeptidyl-peptidase I. 466
  • Active Site S=Serine at location 475 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: TPP1
PPLGFLNPRLYQ3.4.14.9;Tripeptidyl-peptidase I. 498
  • Gene: TPP1
GCHESCL3.4.14.9;Tripeptidyl-peptidase I. 521
  • Gene: TPP1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGLQACLLGLFALILSGKCSYSPEPDQRRTLPPGWVSLGRADPEEELSLTFALRQQNVERLSELVQAVSDPSSPQYGKYLTLENVADLVRPSPLTLHTVQ
KWLLAAGAQKCHSVI
TQDFLTCWLSIRQAELLLPGAEFHHYVGGPTETHVVRSPHPYQLPQALAPHVDFVGGLHRFPPTSSLRQRPEPQVTGTVGLHLGV
TPSV
IRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQGRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHEG
QEPFLQWLMLLSNESALPHVHTVSYGDDEDSLSSAYIQRVNTELMKAAARGLTLLFASGDSGAGCWSVSGRHQFRPTFPASSPYVTTVGGTSFQEPFLIT
NEI
VDYISGGGFSNVFPRPSYQEEAVTKFLSSSPHLPPSSYFNASGRAYPDVAALSDGYWVVSNRVPIPWVSGTSASTPVFGGILSLINEHRILSGRPPL
GFLNPRLYQ
QHGAGLFDVTRGCHESCLDEEVEGQGFCSGPGWDPVTGWGTPNFPALLKTLLNP



DME EC Prediction for this protein is: 3.4.14.9
Check another protein