Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
ILQMICK2.7.7.6;DNA-directed RNA polymerase. 104
  • Metal Site C=Cysteine at location 109 on the protein
  • Metal Site Description: Zinc 2 (By similarity).
  • Gene: RPC1
SGTNEDDLTMKL2.7.7.6;DNA-directed RNA polymerase. 272
  • Gene: RPC1
NLSGKRV2.7.7.6;DNA-directed RNA polymerase. 355 -
GKRVDFS2.7.7.6;DNA-directed RNA polymerase. 358 -
LFNRQPSLH2.7.7.6;DNA-directed RNA polymerase. 461 -
RFNECVC2.7.7.6;DNA-directed RNA polymerase. 487
  • Gene: RPC1
NADFDGD2.7.7.6;DNA-directed RNA polymerase. 497
  • Metal Site D=Aspartic acid at location 499 on the protein
  • Metal Site Description: Magnesium 1; catalytic (By sim
DFDGDEMN2.7.7.6;DNA-directed RNA polymerase. 499
  • Metal Site D=Aspartic acid at location 499 on the protein
  • Metal Site Description: Magnesium 1; catalytic (By sim
NNIFYIL2.7.7.6;DNA-directed RNA polymerase. 661 -
QMIACVGQQ2.7.7.6;DNA-directed RNA polymerase. 794
  • Gene: RPC1
MAGREGL2.7.7.6;DNA-directed RNA polymerase. 852 -
GREGLVD2.7.7.6;DNA-directed RNA polymerase. 854 -
GYMQRRL2.7.7.6;DNA-directed RNA polymerase. 869 -
YGGDGLDP2.7.7.6;DNA-directed RNA polymerase. 902 -
AQSIGEP2.7.7.6;DNA-directed RNA polymerase. 1038 -
GEPGTQMT2.7.7.6;DNA-directed RNA polymerase. 1042 -
TLGVPRIKEIINA2.7.7.6;DNA-directed RNA polymerase. 1064
  • Gene: RPC1
LGIEAAR2.7.7.6;DNA-directed RNA polymerase. 1258 -
MTYKGEVLGITRFGL2.7.7.6;DNA-directed RNA polymerase. 1294
  • Gene: RPC1
LASFEKT2.7.7.6;DNA-directed RNA polymerase. 1318
  • Gene: RPC1
GVSECII2.7.7.6;DNA-directed RNA polymerase. 1342
  • Gene: RPC1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRA
VIG
ILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSNFLQSFETA
IEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLK
SGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRG
NLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKAN
INFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVV
LFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADF
DGDEMN
LHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGI
GDVTPGQGLLKAKYELLNAGYKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTMALCGSKGSFINIS
QMIACVG
QQ
AISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
I
YGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCPSEPALSKNELILTTESIMKKSEFLCCQDSFLQEIKKFIKGVSEKIKKTRDKYGINDNGTTEPRVL
YQLDRITPTQVEKFLETCRDKYMRAQMEPGSAVGALC
AQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAISTPIITAQLDKDDDADYARL
VKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLLRLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKT
LGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEV
LGITRFGL
AKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDTNEFHIPLVT



DME EC Prediction for this protein is: 2.7.7.6
Check another protein