Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DVYELCEVIGKGPFS2.7.11;Protein-serine/threonine kinases. 10 -
QQFAVKIVDVAKFT2.7.11;Protein-serine/threonine kinases. 36
  • Binding Site K=Lysine at location 41 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ICHMLKHPHIVELLETYSS2.7.11;Protein-serine/threonine kinases. 65
  • Domain: Protein kinase
GMLYMVFEFM2.7.11;Protein-serine/threonine kinases. 85
  • Domain: Protein kinase
AGFVYSEAVA2.7.11;Protein-serine/threonine kinases. 109
  • Domain: Protein kinase
QILEALRY2.7.11;Protein-serine/threonine kinases. 124
  • Domain: Protein kinase
NSAPVKLGGFG2.7.11;Protein-serine/threonine kinases. 154
  • Domain: Protein kinase
PYGKPVD2.7.11;Protein-serine/threonine kinases. 195
  • Domain: Protein kinase
SAKDLVR2.7.11.1;Non-specific serine/threonine protein kinase. 248
  • Domain: Protein kinase
FNARRKL2.7.11;Protein-serine/threonine kinases. 298 -
EALRVTPPP2.7.11;Protein-serine/threonine kinases. 455
  • Domain: L27
VTRVRLVQFQKNTDEPMGITLKM2.7.11;Protein-serine/threonine kinases. 485 -
CIVARIMHGGMIHRQ2.7.11;Protein-serine/threonine kinases. 513
  • Domain: PDZ
TLHVGDEIREING2.7.11;Protein-serine/threonine kinases. 529
  • Domain: PDZ
TFKIVPSYR2.7.11;Protein-serine/threonine kinases. 564
  • Domain: PDZ
QIISKDDH2.7.11;Protein-serine/threonine kinases. 647
  • Domain: SH3
AGLIPSPELQEWR2.7.11;Protein-serine/threonine kinases. 669
  • Domain: SH3
DKYLAKHNA2.7.11;Protein-serine/threonine kinases. 710 -
RKTLVLLGAHGVGRRHIKNTLI2.7.11;Protein-serine/threonine kinases. 739
  • Domain: Guanylate kinase-lik
AYPIPHTTRP2.7.11;Protein-serine/threonine kinases. 768
  • Domain: Guanylate kinase-lik
YYFVSHD2.7.11;Protein-serine/threonine kinases. 788
  • Domain: Guanylate kinase-lik
NEYLEYG2.7.11;Protein-serine/threonine kinases. 803
  • Domain: Guanylate kinase-lik
HEDAMYGTKL2.7.11;Protein-serine/threonine kinases. 811
  • Domain: Guanylate kinase-lik
AILDVEPQALK2.7.11;Protein-serine/threonine kinases. 833
  • Domain: Guanylate kinase-lik
VVFIAAP2.7.11;Protein-serine/threonine kinases. 854
  • Domain: Guanylate kinase-lik
PQWVPVSW2.7.11;Protein-serine/threonine kinases. 917 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLC
FEIVKRAD
AGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPV
D
VWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKL
KGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRN
PPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALLQTHDVVAHEVYSD
EALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEP
MGITLKM
NELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS
VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDII
QIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTW
FGKKKKQYK
DKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDI
SN
NEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEID
ETIRHLEEAVELVCTA
PQWVPVSWVY



DME EC Prediction for this protein is: 2.7.11.1
Check another protein