Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NELPAEE3.6.3.8;Calcium-transporting ATPase. 39 -
EQFEDLLVRILL3.6.3.8;Calcium-transporting ATPase. 55 -
LVRILLLAA3.6.3.8;Calcium-transporting ATPase. 61 -
SFVLAWFEEGEET3.6.3.8;Calcium-transporting ATPase. 72 -
AFVEPFVI3.6.3.8;Calcium-transporting ATPase. 87 -
EPFVILLIL3.6.3.8;Calcium-transporting ATPase. 90 -
VGVWQERNAE3.6.3.8;Calcium-transporting ATPase. 104 -
AIEALKEYEPEMGKV3.6.3.8;Calcium-transporting ATPase. 115 -
DRKSVQRIKA3.6.3.8;Calcium-transporting ATPase. 133 -
VPGDIVE3.6.3.8;Calcium-transporting ATPase. 146 -
VGDKVPAD3.6.3.8;Calcium-transporting ATPase. 155 -
STTLRVDQSILTGES3.6.3.8;Calcium-transporting ATPase. 170 -
DQSILTGESVSVIKHT3.6.3.8;Calcium-transporting ATPase. 176 -
PDPRAVNQDKKN3.6.3.8;Calcium-transporting ATPase. 195 -
TEIGKIRD3.6.3.8;Calcium-transporting ATPase. 230 -
TPLQQKLDEF3.6.3.8;Calcium-transporting ATPase. 247 -
KLDEFGEQLSKVISLIC3.6.3.8;Calcium-transporting ATPase. 252 -
INIGHFNDP3.6.3.8;Calcium-transporting ATPase. 274 -
DPVHGGSW3.6.3.8;Calcium-transporting ATPase. 281 -
AIPEGLP3.6.3.8;Calcium-transporting ATPase. 306
  • Metal Site I=Isoleucine at location 307 on the protein
  • Metal Site Description: Calcium 2; via carbonyl oxygen
TTCLALGT3.6.3.8;Calcium-transporting ATPase. 316 -
LPSVETLG3.6.3.8;Calcium-transporting ATPase. 336 -
SVETLGCT3.6.3.8;Calcium-transporting ATPase. 338 -
DKTGTLT3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 351
  • Active Site D=Aspartic acid at location 351 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
DKTGTLTTN3.6.3.8;Calcium-transporting ATPase. 351
  • Active Site D=Aspartic acid at location 351 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
TGSTYAP3.6.3.8;Calcium-transporting ATPase. 385 -
DGLVELATICALCNDS3.6.3.8;Calcium-transporting ATPase. 408 -
EKVGEATETAL3.6.3.8;Calcium-transporting ATPase. 435 -
LVEKMNVF3.6.3.8;Calcium-transporting ATPase. 448 -
ERANACNSVI3.6.3.8;Calcium-transporting ATPase. 466 -
LEFSRDRK3.6.3.8;Calcium-transporting ATPase. 485 -
KMFVKGAPE3.6.3.8;Calcium-transporting ATPase. 511
  • Binding Site K=Lysine at location 515 on the protein
  • Binding site description: ATP (By similarity).
DTLRCLALAT3.6.3.8;Calcium-transporting ATPase. 557 -
VGMLDPPR3.6.3.8;Calcium-transporting ATPase. 597 -
CRDAGIRV3.6.3.8;Calcium-transporting ATPase. 614 -
IMITGDN3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 622 -
MITGDNKGTA3.6.3.8;Calcium-transporting ATPase. 623 -
TGDNKGTA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 625 -
AICRRIG3.6.3.8;Calcium-transporting ATPase. 634 -
CFARVEP3.6.3.8;Calcium-transporting ATPase. 675 -
RVEPSHK3.6.3.8;Calcium-transporting ATPase. 678 -
HKSKIVE3.6.3.8;Calcium-transporting ATPase. 683 -
MTGDGVND3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 700
  • Metal Site D=Aspartic acid at location 703 on the protein
  • Metal Site Description: Magnesium (By similarity).
GDGVNDAP3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 702
  • Metal Site D=Aspartic acid at location 703 on the protein
  • Metal Site Description: Magnesium (By similarity).
IGIAMGSGTAVAK3.6.3.8;Calcium-transporting ATPase. 716 -
EMVLADDNFS3.6.3.8;Calcium-transporting ATPase. 732 -
DDNFSTI3.6.3.8;Calcium-transporting ATPase. 737 -
EGRAIYNN3.6.3.8;Calcium-transporting ATPase. 749 -
FIRYLISSN3.6.3.8;Calcium-transporting ATPase. 760 -
ISSNVGEV3.6.3.8;Calcium-transporting ATPase. 765
  • Metal Site N=Asparagine at location 768 on the protein
  • Metal Site Description: Calcium 1 (By similarity).
IFLTAALG3.6.3.8;Calcium-transporting ATPase. 775 -
VQLLWVN3.6.3.8;Calcium-transporting ATPase. 790 -
LWVNLVTDGLPA3.6.3.8;Calcium-transporting ATPase. 793
  • Metal Site N=Asparagine at location 796 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
GWLFFRY3.6.3.8;Calcium-transporting ATPase. 831 -
YVGAATVG3.6.3.8;Calcium-transporting ATPase. 843 -
TMALSVLVTIEMCNALNS3.6.3.8;Calcium-transporting ATPase. 898
  • Metal Site E=Glutamic acid at location 908 on the protein
  • Metal Site Description: Calcium 1 (By similarity).
NSLSENQSL3.6.3.8;Calcium-transporting ATPase. 914 -
SENQSLLRMPPW3.6.3.8;Calcium-transporting ATPase. 917 -
RMPPWVNIWL3.6.3.8;Calcium-transporting ATPase. 924
  • Gene: AT2A1
LSMSLHF3.6.3.8;Calcium-transporting ATPase. 939 -
VLKISLPVI3.6.3.8;Calcium-transporting ATPase. 970 -
VARNYLE3.6.3.8;Calcium-transporting ATPase. 987 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWELVIEQFEDLLVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIA
NAI
VGVWQERNAENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAV
NQDKKN
MLFSGTNIAAGKALGIVATTGVGTEIGKIRDQMAATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVA
AIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDK
PVRPGQY
DGLVELATICALCNDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMKKEFTLEFSRDRKSMSVYCSP
AKSSRAAVGN
KMFVKGAPEGVIDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGML
DPPR
KEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAM
TGDGVNDAP
ALKKAEIGIAMGSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVTD
GLPA
TALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAIGGYVGAATVGAAAWWFLYAEDGPHVNYSQLTHFMQCTEDNTHFEGIDCEVFEAPEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWL
LGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERR
K



DME EC Prediction for this protein is: 3.6.3.8
Check another protein