Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LERLYQRYF4.6.1.1;Adenylate cyclase. 136 -
LMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAA4.6.1.1;Adenylate cyclase. 194
  • Gene: ADCY6
RMRAAVLSG4.6.1.1;Adenylate cyclase. 256 -
CTHYPAEVSQRQAFQETR4.6.1.1;Adenylate cyclase. 305 -
QQERLLLS4.6.1.1;Adenylate cyclase. 337 -
ERLLLSVLP4.6.1.1;Adenylate cyclase. 339 -
FHKIYIQ4.6.1.1;Adenylate cyclase. 367 -
LASQCTAQELV4.6.1.1;Adenylate cyclase. 391
  • Domain: Guanylate cyclase
RIKILGDCYYC4.6.1.1;Adenylate cyclase. 422
  • Metal Site D=Aspartic acid at location 428 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Domain: Guanylate cyclase
DHAHCCVEMG4.6.1.1;Adenylate cyclase. 442
  • Domain: Guanylate cyclase
MRVGIHSG4.6.1.1;Adenylate cyclase. 471
  • Domain: Guanylate cyclase
CGVLGLRKWQFDVWS4.6.1.1;Adenylate cyclase. 482
  • Domain: Guanylate cyclase
DVTLANHME4.6.1.1;Adenylate cyclase. 498
  • Domain: Guanylate cyclase
AGRIHIT4.6.1.1;Adenylate cyclase. 511 -
LNGDYEVEPG4.6.1.1;Adenylate cyclase. 524 -
IETFLIL4.6.1.1;Adenylate cyclase. 547 -
QKRKEEKAM4.6.1.1;Adenylate cyclase. 557 -
KLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDS4.6.1.1;Adenylate cyclase. 568
  • Gene: ADCY6
NPEDEVDEFL4.6.1.1;Adenylate cyclase. 619 -
RAIDARSID4.6.1.1;Adenylate cyclase. 630 -
HVRRFLLTF4.6.1.1;Adenylate cyclase. 644 -
DLEKKYS4.6.1.1;Adenylate cyclase. 656 -
RFGAYVACA4.6.1.1;Adenylate cyclase. 668 -
PTCSFPEYF4.6.1.1;Adenylate cyclase. 808
  • Gene: ADCY6
RLDFLWK4.6.1.1;Adenylate cyclase. 921 -
EKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDEL4.6.1.1;Adenylate cyclase. 933 -
ECLRLLNEII4.6.1.1;Adenylate cyclase. 1003
  • Domain: Guanylate cyclase
LNEIIADFDEIISE4.6.1.1;Adenylate cyclase. 1008
  • Domain: Guanylate cyclase
EKIKTIG4.6.1.1;Adenylate cyclase. 1028
  • Domain: Guanylate cyclase
TYMAASGLN4.6.1.1;Adenylate cyclase. 1036
  • Domain: Guanylate cyclase
GRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGP4.6.1.1;Adenylate cyclase. 1052
  • Gene: ADCY6
AGVIGARKP4.6.1.1;Adenylate cyclase. 1094
  • Domain: Guanylate cyclase
SRMDSTGV4.6.1.1;Adenylate cyclase. 1115
  • Domain: Guanylate cyclase
YQLECRGVVKVKGKGEM4.6.1.1;Adenylate cyclase. 1141 -
TYFLNGGP4.6.1.1;Adenylate cyclase. 1159 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGPPRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTA
GGTAEVAPDAVPRSGRSCWRRLVQVFQSKQFRSAK
LERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVGLMVVCNR
HSFRQDSMWVVSYVVLGILAAVQVGGALAA
DPRSPSAGLWCPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGI
CTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQEL
V
MTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVT
LANHME
AGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDS
SKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGI
YASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDA
PLCEGTM
PTCSFPEYFIGNMLLSLLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTA
RLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNE
GV
ECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGAR
KP
QYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS



DME EC Prediction for this protein is: 4.6.1.1
Check another protein