Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WPLLLKN5.4.99;Transferring other groups. 52 -
NLDKPSNPSSHEVV5.4.99;Transferring other groups. 93 -
SHEVVAW5.4.99;Transferring other groups. 102 -
GTLDPKV5.4.99;Transferring other groups. 122
  • Active Site D=Aspartic acid at location 125 on the protein
  • Active Site Description: Nucleophile (By similarity).
LDPKVTG5.4.99;Transferring other groups. 124
  • Active Site D=Aspartic acid at location 125 on the protein
  • Active Site Description: Nucleophile (By similarity).
GCLIVCI5.4.99;Transferring other groups. 130 -
RATRLVKSQQ5.4.99;Transferring other groups. 138 -
AVKRQLR5.4.99;Transferring other groups. 189 -
CVHLGLLLGVGG5.4.99;Transferring other groups. 230 -
ELRRVRSG5.4.99;Transferring other groups. 245 -
NAICYGAK5.4.99;Transferring other groups. 307
  • Domain: PUA
AIALMTTA5.4.99;Transferring other groups. 346
  • Domain: PUA
  • Gene: DKC1
KRVIMERD5.4.99;Transferring other groups. 367
  • Domain: PUA
  • Gene: DKC1
RDTYPRKWGLGP5.4.99;Transferring other groups. 373
  • Gene: DKC1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNP
SSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAGKEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIY
ESKMIEYDPERRLGIFWVSCEAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV
MKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDTYPRKWGLGPKASQKKLMIKQGLLDK
HGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRESESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKK
KKKKKAKEVELVSE


DME EC Prediction for this protein is: 5.4.99
Check another protein