Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PRCGVPD3.4.24;Metalloendopeptidases. 98
  • Metal Site C=Cysteine at location 100 on the protein
  • Metal Site Description: Zinc; in inhibited form (By si
GEADIMI3.4.24;Metalloendopeptidases. 163
  • Metal Site D=Aspartic acid at location 166 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
LAHAFAPG3.4.24;Metalloendopeptidases. 189
  • Metal Site H=Histidine at location 191 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
VAAHEFGH3.4.24;Metalloendopeptidases. 223
  • Active Site E=Glutamic acid at location 227 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 226 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
VAAHEFGHALGL3.4.24.35;Gelatinase B. 223
  • Active Site E=Glutamic acid at location 227 on the protein
  • Active Site Description: By similarity.
  • Metal Site H=Histidine at location 226 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
LPKDDVKGIQALYGPR3.4.24;Metalloendopeptidases. 258
  • Gene: MMP20
SFDAVTML3.4.24.22;Stromelysin 2. 301 -
FFKGPHYW3.4.24;Metalloendopeptidases. 361
  • Domain: Hemopexin-like
  • Gene: MMP20
EYYSYDERK3.4.24;Metalloendopeptidases. 413
  • Domain: Hemopexin-like
  • Gene: MMP20
NGYIYFF3.4.24;Metalloendopeptidases. 450
  • Domain: Hemopexin-like
DTEKEDVVS3.4.24;Metalloendopeptidases. 465
  • Domain: Hemopexin-like
  • Gene: MMP20

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRC
GVPD
VANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLG
GDTHFDNAEKWTMGTNGFNLFT
VAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSS
SFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYL
REPQKTLFFVGD
EYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC



DME EC Prediction for this protein is: 3.4.24.35
Check another protein