Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GDEMTRIIW1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 15 -
LDLHSYDL1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 37
  • Gene: IDHC
NRDATNDQVT1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 48 -
MWKSPNGTIRN1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 91 -
SPNGTIRNIL1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 94 -
IICKNIPRL1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 112 -
KPIIIGRHA1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 126
  • Binding Site R=Arginine at location 132 on the protein
  • Binding site description: Substrate (By similarity).
GDQYRAT1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 136 -
QKVTYLVH1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 163
  • Gene: IDHC
GVAMGMYN1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 177 -
NQDKSIEDFAHSSFQMALSK1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 184
  • Gene: IDHC
TKNTILK1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 211 -
YDGRFKDIFQ1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 219 -
YEHRLIDDMVA1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 246
  • Metal Site D=Aspartic acid at location 252 on the protein
  • Metal Site Description: Magnesium or manganese (By sim
WACKNYDGDV1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 267
  • Metal Site D=Aspartic acid at location 275 on the protein
  • Metal Site Description: Magnesium or manganese (By sim
KNYDGDVQSD1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 270
  • Metal Site D=Aspartic acid at location 275 on the protein
  • Metal Site Description: Magnesium or manganese (By sim
EAAHGTV1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 306 -
HGTVTRH1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 309 -
IASIFAW1.1.1.42;Isocitrate dehydrogenase (NADP(+)). 330 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIR
NIL
GGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA
LSK
GWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEA
EAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDK
LGENLKIKLAQAKL



DME EC Prediction for this protein is: 1.1.1.42
Check another protein