Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VCKRGFTVI2.7.11.1;Non-specific serine/threonine protein kinase. 119
  • Domain: CRAL-TRIO
IHVALIIKPDNFWQKQ2.7.11.1;Non-specific serine/threonine protein kinase. 153
  • Domain: CRAL-TRIO
LDQCFQLRLFEQDAEKMFDWI2.7.11.1;Non-specific serine/threonine protein kinase. 336 -
GHYASQQI2.7.11.1;Non-specific serine/threonine protein kinase. 412 -
ANYSKAVH2.7.11.1;Non-specific serine/threonine protein kinase. 528 -
IWQHRKVRLHQRLQLCVFQQ2.7.11.1;Non-specific serine/threonine protein kinase. 554 -
LLDMSVSFHTH2.7.11.1;Non-specific serine/threonine protein kinase. 669 -
FLQLRIFE2.7.11.1;Non-specific serine/threonine protein kinase. 785 -
KTHQSALQVQQKAE2.7.11.1;Non-specific serine/threonine protein kinase. 959 -
QRENRVLH2.7.11.1;Non-specific serine/threonine protein kinase. 1118 -
KRRLDQCQQYVVFERSAKQAL2.7.11.1;Non-specific serine/threonine protein kinase. 1131 -
ELNEEKR2.7.11.1;Non-specific serine/threonine protein kinase. 1281 -
NIFLKELEKYEQLPEDVGHCFVTWADKFQMYV2.7.11.1;Non-specific serine/threonine protein kinase. 1353
  • Domain: DH
KYQLLLK2.7.11.1;Non-specific serine/threonine protein kinase. 1431
  • Domain: DH
DPCKFAL2.7.11.1;Non-specific serine/threonine protein kinase. 1551
  • Domain: PH
KYQLLLK2.7.11.1;Non-specific serine/threonine protein kinase. 2106
  • Domain: DH
DPCKFAL2.7.11.1;Non-specific serine/threonine protein kinase. 2232
  • Domain: PH
SPIEYQR2.7.11.1;Non-specific serine/threonine protein kinase. 2282 -
LSGVSPFLD2.7.11.1;Non-specific serine/threonine protein kinase. 2986
  • Domain: Protein kinase
RRKHQND2.7.11.1;Non-specific serine/threonine protein kinase. 3072 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSGSSGGAAAPAASSGPAAAASAAGSGCGGGAGEGAEEAAKDLADIAAFFRSGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIR
QEDLRRLISYLACIPSEE
VCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFETNMVSLEGLTKVVDPSQLTP
EFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGSG
NADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLK
LDQCFQLRLFEQDAEKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINR
IMSVANRLVES
GHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQDLEDAIHHHQGIYEHITLAYSE
VSQDGKSLLDKLQRPLTPGSSDSLTAS
ANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSL
HRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFVRRVEQRKI
LLDMSVSFHTHVKELWTWLEELQKELLDDVYA
ESVEAVQDLIKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKIKLEL
FLQLRIFERDAIDIIS
DLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHR
KHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIE
KTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLM
LKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRNADVFLKYLHRNSVNMPGMVT
HIKAPEQQVKNILNELF
QRENRVLHYWTMRKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLI
QLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQLDIIPASIPGSEVKLRDAAH
ELNEEKRKSARRKEFIMAEL
IQTEKAYVRDLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHN
NIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSTQLILEH
AGSYFDEIQQRHGLANSISSYLIKPVQRIT
KYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKTL
IRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEG
DPCKFALWVGRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGA
LKEPIHIPKTAPATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRRGQTVEVLERPHDKPDWCLVRT
TDRSPAAEGLVPCGSLCIAHSRSSMEMEGIFNHKDSLSVSSNDASPPASVASLQPHMIGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLAHKH
KKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTS
SETPSAAELVSAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRRHYVLQELVETERDYVRDLGYVVEGYMALMK
EDGVPDDMKGKDKIVFGNIHQIYDWHRDFFLGELEKCLEDPEKLGSLFVKHERRLHMYIAYCQNKPKSEHIVSEYIDTFFEDLKQRLGHRLQLTDLLIKP
VQRIM
KYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPRRCNDMMNVGRLQGFDGKIVAQGKLLLQDTFLVTDQDAGLLPRCRERRIFLFEQIVIFSEP
LDKKKGFSMPGFLFKNSIKVSCLCLEENVEN
DPCKFALTSRTGDVVETFILHSSSPSVRQTWIHEINQILENQRNFLNALTSPIEYQRNHSGGGGGGGSG
GSGGGGGSGGGGAPSGGSGHSGGPSSCGGAPSTSRSRPSRIPQPVRHHPPVLVSSAASSQAEADKMSGTSTPGPSLPPPGAAPEAGPSAPSRRPPGADAE
GSEREAEPIPKMKVLESPRKGAANASGSSPDAPAKDARASLGTLPLGKPRAGAASPLNSPLSSAVPSLGKEPFPPSSPLQKGGSFWSSIPASPASRPGSF
TFPGDSDSLQRQTPRHAAPGKDTDRMSTCSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNMFLVFRAATDQCP
AAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGE
TVVLRCRVCGRPKASITWKGPEHNTLNNDGHYSISYSDLGEATLKIVGVTTEDDGIYTCIAVNDMGSASSSASLRVLGPGMDGIMVTWKDNFDSFYSEVA
ELGRGRFSVVKKCDQKGTKRAVATKFVNKKLMKRDQVTHELGILQSLQHPLLVGLLDTFETPTSYILVLEMADQGRLLDCVVRWGSLTEGKIRAHLGEVL
EAVRYLHNCRIAHLDLKPENILVDESLAKPTIKLADFGDAVQLNTTYYIHQLLGNPEFAAPEIILGNPVSLTSDTWSVGVLTYVL
LSGVSPFLDDSVEET
CLNICRLDFSFPDDYFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQAGNGRSTGVLDTSRLTSFIE
RRKHQNDVRPIRSIKNFLQSRLLPRV



DME EC Prediction for this protein is: 2.7.11.1
Check another protein