Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GWKLTLV3.6.3.44;Xenobiotic-transporting ATPase. 238
  • Domain: ABC transmembrane ty
ENIRYGR3.6.3.44;Xenobiotic-transporting ATPase. 514
  • Domain: ABC transporter
KQRVAIA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 564
  • Domain: ABC transporter
QRVAIAR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 565
  • Domain: ABC transporter
ALDNESE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 588
  • Domain: ABC transporter
  • Gene: MSBA
VSQEPVLF3.6.3.44;Xenobiotic-transporting ATPase. 1159
  • Domain: ABC transporter
QRIAIARA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1225
  • Domain: ABC transporter
KILLLDE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1238
  • Domain: ABC transporter
LLLDEATSALD3.6.3.44;Xenobiotic-transporting ATPase. 1240
  • Domain: ABC transporter
LDEATSALDTESE3.6.3.44;Xenobiotic-transporting ATPase. 1242
  • Domain: ABC transporter
ALDKAREGRT3.6.3.44;Xenobiotic-transporting ATPase. 1260
  • Domain: ABC transporter
VIAHRLST3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1272
  • Domain: ABC transporter
VIAHRLSTIQNAD3.6.3.44;Xenobiotic-transporting ATPase. 1272
  • Domain: ABC transporter
AHRLSTI3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1274
  • Domain: ABC transporter

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIWLMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQEL
QIPGKACVNNTIVWTNSSLNQNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFRRIMRMEIGWFDCNSVGELNT
RFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFR
GWKLTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE
VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLVQIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRK
PIIDCMSEDGYKLDRIKGEIEFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVTVDGHDIRSLNIQWLRDQIGI
VEQEPVLFSTTIA
ENIRYGREDATMEDIVQAAKEANAYNFIMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV
LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQGNQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSK
SQLSYLVHEPPLAVVDHKSTYEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQILGTFSIPDKEEQRSQINGVCL
LFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAMLGQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL
SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFIEALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASY
RYGGYLISNEGLHFSYVFRVISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDFVDCKFTYPSRPDSQVLNGLS
VSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMIDGHDSKKVNVQFLRSNIGI
VSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF
VMSLPEKYETNVGSQGSQLSRGEK
QRIAIARAIVRDPKILLLDEATSALDTESEKTVQVALDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTH
EELMAQKGAYYKLVTTGSPIS



DME EC Prediction for this protein is: 3.6.3.44
Check another protein