Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NKITVVGVG1.1.1.27;L-lactate dehydrogenase. 21 -
ACAISIL1.1.1.27;L-lactate dehydrogenase. 34 -
DELALVDV1.1.1.27;L-lactate dehydrogenase. 46 -
EDKLKGE1.1.1.27;L-lactate dehydrogenase. 55 -
MDLQHGS1.1.1.27;L-lactate dehydrogenase. 63 -
DLQHGSLFL1.1.1.27;L-lactate dehydrogenase. 64 -
KIVSGKDY1.1.1.27;L-lactate dehydrogenase. 76 -
ANSKLVI1.1.1.27;L-lactate dehydrogenase. 87 -
LVIITAGARQ1.1.1.27;L-lactate dehydrogenase. 91
  • Binding Site R=Arginine at location 99 on the protein
  • Binding site description: NAD (By similarity).
TAGARQQEGE1.1.1.27;L-lactate dehydrogenase. 95
  • Binding Site R=Arginine at location 99 on the protein
  • Binding site description: NAD (By similarity).
QRNVNIFK1.1.1.27;L-lactate dehydrogenase. 111 -
PNVVKYSP1.1.1.27;L-lactate dehydrogenase. 122
  • Gene: LDHA
VKYSPNC1.1.1;With NAD(+) or NADP(+) as acceptor. 125 -
NPVDILT1.1.1.27;L-lactate dehydrogenase. 138
  • Binding Site N=Asparagine at location 138 on the protein
  • Binding site description: NAD or substrate (By similarit
TYVAWKISGFPK1.1.1.27;L-lactate dehydrogenase. 144
  • Gene: LDHA
GFPKNRV1.1.1;With NAD(+) or NADP(+) as acceptor. 152 -
PKNRVIG1.1.1;With NAD(+) or NADP(+) as acceptor. 154 -
IGSGCNLD1.1.1.27;L-lactate dehydrogenase. 159 -
NLDSARFR1.1.1.27;L-lactate dehydrogenase. 164
  • Binding Site R=Arginine at location 169 on the protein
  • Binding site description: Substrate (By similarity).
LDSARFR1.1.1;With NAD(+) or NADP(+) as acceptor. 165
  • Binding Site R=Arginine at location 169 on the protein
  • Binding site description: Substrate (By similarity).
ARFRYLM1.1.1.27;L-lactate dehydrogenase. 168
  • Binding Site R=Arginine at location 169 on the protein
  • Binding site description: Substrate (By similarity).
GWVLGEHGD1.1.1.27;L-lactate dehydrogenase. 187
  • Active Site H=Histidine at location 193 on the protein
  • Active Site Description: Proton acceptor (By similarity
GEHGDSSV1.1.1.27;L-lactate dehydrogenase. 191
  • Active Site H=Histidine at location 193 on the protein
  • Active Site Description: Proton acceptor (By similarity
NVAGVSLK1.1.1.27;L-lactate dehydrogenase. 205
  • Gene: LDHA
WKEVHKQVV1.1.1.27;L-lactate dehydrogenase. 227 -
VVESAYE1.1.1.27;L-lactate dehydrogenase. 234 -
IKLKGYT1.1.1.27;L-lactate dehydrogenase. 242 -
WAIGLSV1.1.1.27;L-lactate dehydrogenase. 250 -
NLRRVHP1.1.1.27;L-lactate dehydrogenase. 266 -
VFLSVPC1.1.1.27;L-lactate dehydrogenase. 287 -
KSADTLW1.1.1.27;L-lactate dehydrogenase. 318 -
TLWGIQK1.1.1.27;L-lactate dehydrogenase. 322 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQ
QEGE
SRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPV
WSGM
NVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI
SDLVKVTLTSEEEARLK
KSADTLWGIQKELQF



DME EC Prediction for this protein is: 1.1.1.27
Check another protein