Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
STNHKDIG1.9.3.1;Cytochrome-c oxidase. 9 -
LSLLIRAEL1.9.3.1;Cytochrome-c oxidase. 33
  • Gene: COX1
IRAELGQPG1.9.3.1;Cytochrome-c oxidase. 37
  • Gene: COX1
IVTAHAF1.9.3.1;Cytochrome-c oxidase. 57
  • Metal Site H=Histidine at location 61 on the protein
  • Metal Site Description: Iron (heme A axial ligand) (By
  • Gene: COX1
VTAHAFVMIFFMVMP1.9.3.1;Cytochrome-c oxidase. 58
  • Metal Site H=Histidine at location 61 on the protein
  • Metal Site Description: Iron (heme A axial ligand) (Pr
  • Gene: COX1
MIFFMVMPI1.9.3.1;Cytochrome-c oxidase. 65
  • Gene: COX1
GGFGNWL1.9.3.1;Cytochrome-c oxidase. 76
  • Gene: COX1
PDMAFPRMNN1.9.3.1;Cytochrome-c oxidase. 90
  • Gene: COX1
VEAGAGTGWTVYPPLAGN1.9.3.1;Cytochrome-c oxidase. 118
  • Gene: COX1
IFSLHLAG1.9.3.1;Cytochrome-c oxidase. 147
  • Gene: COX1
GVSSILG1.9.3.1;Cytochrome-c oxidase. 154
  • Gene: COX1
SILGAIN1.9.3.1;Cytochrome-c oxidase. 157 -
LGAINFITT1.9.3.1;Cytochrome-c oxidase. 159
  • Gene: COX1
NFITTII1.9.3.1;Cytochrome-c oxidase. 163 -
TIINMKP1.9.3.1;Cytochrome-c oxidase. 167
  • Gene: COX1
INMKPPA1.9.3.1;Cytochrome-c oxidase. 169
  • Gene: COX1
QYQTPLF1.9.3.1;Cytochrome-c oxidase. 178
  • Gene: COX1
PLFVWSV1.9.3.1;Cytochrome-c oxidase. 182
  • Gene: COX1
WSVLITA1.9.3.1;Cytochrome-c oxidase. 186
  • Gene: COX1
ITAVLLLLSLPVLA1.9.3.1;Cytochrome-c oxidase. 190
  • Gene: COX1
LLLLSLPVLAA1.9.3.1;Cytochrome-c oxidase. 194
  • Gene: COX1
TDRNLNT1.9.3.1;Cytochrome-c oxidase. 211
  • Gene: COX1
NTTFFDP1.9.3.1;Cytochrome-c oxidase. 216
  • Gene: COX1
FFDPAGG1.9.3.1;Cytochrome-c oxidase. 219 -
HPEVYILILPGFG1.9.3.1;Cytochrome-c oxidase. 240
  • Metal Site H=Histidine at location 240 on the protein
  • Metal Site Description: Copper B (By similarity).
  • Binding Site Y=Tyrosine at location 244 on the protein
  • Binding site description: Oxygen (Probable).
  • Gene: COX1
GKKEPFG1.9.3.1;Cytochrome-c oxidase. 263
  • Gene: COX1
LGFIVWAHHM1.9.3.1;Cytochrome-c oxidase. 283
  • Metal Site H=Histidine at location 290 on the protein
  • Metal Site Description: Copper B (By similarity).
VWAHHMFTVG1.9.3.1;Cytochrome-c oxidase. 287
  • Metal Site H=Histidine at location 290 on the protein
  • Metal Site Description: Copper B (By similarity).
MDVDTRAYFTSATMIIAIPTG1.9.3.1;Cytochrome-c oxidase. 297
  • Gene: COX1
GFIFLFT1.9.3.1;Cytochrome-c oxidase. 343
  • Gene: COX1
FLFTVGG1.9.3.1;Cytochrome-c oxidase. 346 -
TVGGLTG1.9.3.1;Cytochrome-c oxidase. 349
  • Gene: COX1
GGLTGIVL1.9.3.1;Cytochrome-c oxidase. 351
  • Gene: COX1
LANSSLDI1.9.3.1;Cytochrome-c oxidase. 358
  • Gene: COX1
HDTYYVV1.9.3.1;Cytochrome-c oxidase. 368
  • Metal Site H=Histidine at location 368 on the protein
  • Metal Site Description: Iron (heme A axial ligand) (Pr
HFHYVLS1.9.3.1;Cytochrome-c oxidase. 376
  • Metal Site H=Histidine at location 376 on the protein
  • Metal Site Description: Iron (heme A3 axial ligand) (P
  • Gene: COX1
MGAVFAIM1.9.3.1;Cytochrome-c oxidase. 383
  • Gene: COX1
HWFPLFSGY1.9.3.1;Cytochrome-c oxidase. 395
  • Gene: COX1
AKIHFTIMF1.9.3.1;Cytochrome-c oxidase. 410
  • Gene: COX1
FIGVNLTF1.9.3.1;Cytochrome-c oxidase. 418
  • Gene: COX1
GVNLTFFP1.9.3.1;Cytochrome-c oxidase. 420
  • Gene: COX1
PQHFLGL1.9.3.1;Cytochrome-c oxidase. 427
  • Gene: COX1
GMPRRYSD1.9.3.1;Cytochrome-c oxidase. 435
  • Gene: COX1
MPRRYSDYPDAY1.9.3.1;Cytochrome-c oxidase. 436
  • Gene: COX1
GSFISLTAV1.9.3.1;Cytochrome-c oxidase. 457
  • Gene: COX1
WEAFASKR1.9.3.1;Cytochrome-c oxidase. 473
  • Gene: COX1
GCPPPYHTFE1.9.3.1;Cytochrome-c oxidase. 497
  • Gene: COX1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNM
SFWLLPPSLLLLLASAM
VEAGAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLP
VLAA
GITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTG
VKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLF
SGY
TLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPP
PYHTFE
EPVYMKS



DME EC Prediction for this protein is: 1.9.3.1
Check another protein