Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
QLKGRDLLTLKN2.1.3.3;Ornithine carbamoyltransferase. 36
  • Gene: OTC
KGEYLPLLQGKSL2.1.3.3;Ornithine carbamoyltransferase. 70
  • Gene: OTC
KRSTRTR2.1.3.3;Ornithine carbamoyltransferase. 88
  • Gene: OTC
ETGFALLGGH2.1.3.3;Ornithine carbamoyltransferase. 98
  • Gene: OTC
LGVNESL2.1.3.3;Ornithine carbamoyltransferase. 118
  • Gene: OTC
DTARVLS2.1.3;Carboxyl- and carbamoyltransferases. 126 -
RVYKQSDL2.1.3.3;Ornithine carbamoyltransferase. 141
  • Binding Site R=Arginine at location 141 on the protein
  • Binding site description: Carbamoyl phosphate (By simila
  • Gene: OTC
WIGDGNN2.1.3.3;Ornithine carbamoyltransferase. 193 -
LHSIMMSAAKFGMHL2.1.3.3;Ornithine carbamoyltransferase. 201
  • Gene: OTC
TNDPLEA2.1.3.3;Ornithine carbamoyltransferase. 247
  • Gene: OTC
TDTWISM2.1.3.3;Ornithine carbamoyltransferase. 262
  • Active Site D=Aspartic acid at location 263 on the protein
  • Active Site Description: By similarity.
  • Gene: OTC
SMGQEEE2.1.3.3;Ornithine carbamoyltransferase. 267 -
WTFLHCLPRKPEEVDD2.1.3.3;Ornithine carbamoyltransferase. 298
  • Active Site C=Cysteine at location 303 on the protein
  • Active Site Description: By similarity.
  • Gene: OTC
EVDDEVFY2.1.3.3;Ornithine carbamoyltransferase. 310
  • Gene: OTC
SLVFPEAENR2.1.3.3;Ornithine carbamoyltransferase. 321
  • Gene: OTC

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETG
FALLGGH
PCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNI
LHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFY
SPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF



DME EC Prediction for this protein is: 2.1.3.3
Check another protein