Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VHLFKERWD2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 51
  • Gene: F13A
LIVRRGQ2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 75 -
YPQENKGTYIPVP2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 109
  • Gene: F13A
YILFNPWC2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 182 -
YGQCWVFA2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 312
  • Active Site C=Cysteine at location 315 on the protein
  • Active Site Description: By similarity.
WMTRPDL2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 380 -
GGWQAVDSTPQE2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 391
  • Active Site D=Aspartic acid at location 397 on the protein
  • Active Site Description: By similarity.
FAEVNSD2.3.2.13;Protein-glutamine gamma-glutamyltransferase. 433
  • Metal Site N=Asparagine at location 437 on the protein
  • Metal Site Description: Calcium (By similarity).

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDTNKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLF
RVEYVIGR
YPQENKGTYIPVPIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEK
EREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSENPVR
YGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTP
QE
NSDGMYRCGPASVQAIKHGHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEEERLALETALM
YGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITFRNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL
EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVQFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWV
SGHRKLIASMSSDSLRHVYGELDVQIQRRPSM



DME EC Prediction for this protein is: 2.3.2.13
Check another protein