Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GYDLDLFCIP2.4.2.8;Hypoxanthine phosphoribosyltransferase. 16
  • Gene: HPRT
IPHGLIMDRTERLAR2.4.2.8;Hypoxanthine phosphoribosyltransferase. 37
  • Gene: HPRT
MGGHHIVALCVLKGGYKFFADLLDYIKALNRNSD2.4.2.8;Hypoxanthine phosphoribosyltransferase. 57
  • Gene: HPRT
KSYCNDQSTG2.4.2.8;Hypoxanthine phosphoribosyltransferase. 103 -
VLIVEDI2.4.2.8;Hypoxanthine phosphoribosyltransferase. 130 -
LIVEDIID2.4.2.8;Hypoxanthine phosphoribosyltransferase. 131 -
VEDIIDTG2.4.2.8;Hypoxanthine phosphoribosyltransferase. 133 -
VKVASLLVKRT2.4.2.8;Hypoxanthine phosphoribosyltransferase. 158
  • Gene: HPRT
FVVGYALDYN2.4.2.8;Hypoxanthine phosphoribosyltransferase. 187
  • Metal Site D=Aspartic acid at location 194 on the protein
  • Metal Site Description: Magnesium 1 (By similarity).
  • Gene: HPRT
FRDLNHVCVISE2.4.2.8;Hypoxanthine phosphoribosyltransferase. 199
  • Gene: HPRT
CVISETGK2.4.2.8;Hypoxanthine phosphoribosyltransferase. 206
  • Gene: HPRT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFI
RL
KSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFR
DLNHVCVISETGK
AKYKA



DME EC Prediction for this protein is: 2.4.2.8
Check another protein