Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RVDFNVP2.7.2.3;Phosphoglycerate kinase. 22 -
ITNNQRI2.7.2.3;Phosphoglycerate kinase. 34
  • Binding Site R=Arginine at location 39 on the protein
  • Binding site description: Substrate (By similarity).
LDNGAKS2.7.2.3;Phosphoglycerate kinase. 51 -
MSHLGRP2.7.2.3;Phosphoglycerate kinase. 61 -
MPDKYSLEPVA2.7.2.3;Phosphoglycerate kinase. 72 -
ELKSLLGKDVLFLKDCVG2.7.2.3;Phosphoglycerate kinase. 84 -
DCVGPEV2.7.2.3;Phosphoglycerate kinase. 98 -
GSVILLEN2.7.2.3;Phosphoglycerate kinase. 114 -
LLENLRF2.7.2.3;Phosphoglycerate kinase. 118
  • Binding Site R=Arginine at location 123 on the protein
  • Binding site description: Substrate (By similarity).
LENLRFH2.7.2.3;Phosphoglycerate kinase. 119
  • Binding Site R=Arginine at location 123 on the protein
  • Binding site description: Substrate (By similarity).
DVYVNDAF2.7.2.3;Phosphoglycerate kinase. 159 -
VNDAFGT2.7.2.3;Phosphoglycerate kinase. 162 -
DAFGTAHR2.7.2.3;Phosphoglycerate kinase. 164 -
RAHSSMVG2.7.2.3;Phosphoglycerate kinase. 171
  • Binding Site R=Arginine at location 171 on the protein
  • Binding site description: Substrate (By similarity).
AILGGAK2.7.2.3;Phosphoglycerate kinase. 210 -
DKIQLINN2.7.2.3;Phosphoglycerate kinase. 219
  • Binding Site K=Lysine at location 220 on the protein
  • Binding site description: ATP (By similarity).
NMLDKVNEMIIGGGM2.7.2.3;Phosphoglycerate kinase. 226 -
GGMAFTF2.7.2.3;Phosphoglycerate kinase. 238 -
TFLKVLNNMEIG2.7.2.3;Phosphoglycerate kinase. 243 -
SLFDEEG2.7.2.3;Phosphoglycerate kinase. 256 -
DEEGAKIV2.7.2.3;Phosphoglycerate kinase. 259 -
KIVKDLM2.7.2.3;Phosphoglycerate kinase. 264 -
KAEKNGVKITLPVDF2.7.2.3;Phosphoglycerate kinase. 272 -
DKFDENA2.7.2.3;Phosphoglycerate kinase. 290 -
ESSKKYAEAV2.7.2.3;Phosphoglycerate kinase. 319
  • Gene: PGK1
WNGPVGVFE2.7.2.3;Phosphoglycerate kinase. 336 -
GTKALMDE2.7.2.3;Phosphoglycerate kinase. 351 -
MDEVVKAT2.7.2.3;Phosphoglycerate kinase. 356 -
TIIGGGD2.7.2.3;Phosphoglycerate kinase. 369 -
GGGDTATCC2.7.2.3;Phosphoglycerate kinase. 372 -
DKVSHVSTGGG2.7.2.3;Phosphoglycerate kinase. 387 -
STGGGAS2.7.2.3;Phosphoglycerate kinase. 393 -
EGKVLPG2.7.2.3;Phosphoglycerate kinase. 404 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCV
GPEV
EKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKA
LESPERPFL
AILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGLDCGP
ESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASL
ELL
EGKVLPGVDALSNI



DME EC Prediction for this protein is: 2.7.2.3
Check another protein