Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GNLEREC3.4.21;Serine endopeptidases. 54
  • Domain: Gla
INSTTHPGADL3.4.21.5;Thrombin. 142
  • Domain: Kringle
  • Gene: THRB
PWCYTTDP3.4.21;Serine endopeptidases. 167
  • Domain: Kringle
CSIPVCGQ3.4.21.5;Thrombin. 181
  • Domain: Kringle
  • Gene: THRB
CRNPDGD3.4.21;Serine endopeptidases. 262
  • Domain: Kringle
GEADCGLRPLFEK3.4.21.5;Thrombin. 332
  • Gene: THRB
WVLTAAH3.4.21;Serine endopeptidases. 400
  • Domain: Peptidase S1
VLTAAHC3.4.21;Serine endopeptidases. 401
  • Active Site H=Histidine at location 406 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
DLLVRIGKHSRTRYER3.4.21.5;Thrombin. 421
  • Domain: Peptidase S1
  • Gene: THRB
EKISMLEKIY3.4.21.5;Thrombin. 439
  • Domain: Peptidase S1
  • Gene: THRB
KIYIHPRYNW3.4.21.5;Thrombin. 446
  • Domain: Peptidase S1
  • Gene: THRB
AGYKGRVTGWGNL3.4.21.5;Thrombin. 495
  • Domain: Peptidase S1
  • Gene: THRB
KRGDACEGDSGGPFVMKSP3.4.21.5;Thrombin. 559
  • Active Site S=Serine at location 568 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
  • Gene: THRB
DACEGDSGGP3.4.21;Serine endopeptidases. 562
  • Active Site S=Serine at location 568 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
GKYGFYTHVFRLK3.4.21.5;Thrombin. 598
  • Domain: Peptidase S1
  • Gene: THRB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKL
AACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKPE
INSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSE
GSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENF
CRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGS
GEADCGLRPLFEKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRW
VLTAAHC
LLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGR
VTGWGNL
KETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLK
KWIQKVIDQFGE



DME EC Prediction for this protein is: 3.4.21.5
Check another protein