Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
CRAFQYHSK3.4.21.7;Plasmin. 61
  • Domain: PAN
  • Gene: PLMN
FQYHSKEQQCV3.4.21.7;Plasmin. 64
  • Domain: PAN
  • Gene: PLMN
RDVVLFEK3.4.21.7;Plasmin. 89
  • Domain: PAN
  • Gene: PLMN
YLSECKTGNGKNYRGT3.4.21.7;Plasmin. 99
  • Gene: PLMN
LEENYCRNP3.4.21.7;Plasmin. 147
  • Domain: Kringle
  • Gene: PLMN
NYCRNPD3.4.21;Serine endopeptidases. 150
  • Domain: Kringle
PWCYTTDP3.4.21;Serine endopeptidases. 162
  • Domain: Kringle
TMSGLECQ3.4.21.7;Plasmin. 200
  • Domain: Kringle
  • Gene: PLMN
SQSPHAHGY3.4.21.7;Plasmin. 211
  • Domain: Kringle
  • Gene: PLMN
PSKFPNKNLK3.4.21.7;Plasmin. 221
  • Domain: Kringle
  • Gene: PLMN
NYCRNPD3.4.21;Serine endopeptidases. 232
  • Domain: Kringle
PWCFTTDP3.4.21.7;Plasmin. 243
  • Domain: Kringle
  • Gene: PLMN
CDIPRCTTPPP3.4.21.7;Plasmin. 257
  • Domain: Kringle
  • Gene: PLMN
HNRTPENFPC3.4.21.7;Plasmin. 307
  • Domain: Kringle
  • Gene: PLMN
NYCRNPD3.4.21;Serine endopeptidases. 322
  • Domain: Kringle
VQDCYHGDG3.4.21.7;Plasmin. 374
  • Domain: Kringle
GQSYRGT3.4.21.7;Plasmin. 382
  • Domain: Kringle
YRGTSSTT3.4.21.7;Plasmin. 385
  • Domain: Kringle
CQSWSSM3.4.21.7;Plasmin. 398
  • Domain: Kringle
NYCRNPD3.4.21;Serine endopeptidases. 424
  • Domain: Kringle
PWCFTTDP3.4.21.7;Plasmin. 435
  • Domain: Kringle
  • Gene: PLMN
VRWEYCNL3.4.21.7;Plasmin. 444
  • Binding Site R=Arginine at location 445 on the protein
  • Binding site description: Omega-aminocarboxylic acids (B
  • Domain: Kringle
AQEPHRH3.4.21.7;Plasmin. 507
  • Domain: Kringle
TNPRAGLEKNYCRNPDGD3.4.21.7;Plasmin. 520
  • Domain: Kringle
  • Gene: PLMN
NYCRNPD3.4.21;Serine endopeptidases. 529
  • Domain: Kringle
CRNPDGD3.4.21;Serine endopeptidases. 531
  • Domain: Kringle
WPWQVSL3.4.21;Serine endopeptidases. 592
  • Domain: Peptidase S1
HFCGGTLISPEWV3.4.21.7;Plasmin. 605
  • Domain: Peptidase S1
WVLTAAH3.4.21;Serine endopeptidases. 616
  • Domain: Peptidase S1
VLTAAHC3.4.21;Serine endopeptidases. 617
  • Active Site H=Histidine at location 622 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
YKVILGAH3.4.21.7;Plasmin. 633
  • Domain: Peptidase S1
DIALLKLSSP3.4.21.7;Plasmin. 665
  • Active Site D=Aspartic acid at location 665 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
TGWGETQ3.4.21.7;Plasmin. 702
  • Domain: Peptidase S1
WGETQGT3.4.21.7;Plasmin. 704
  • Domain: Peptidase S1
LPVIENKVCNR3.4.21.7;Plasmin. 721
  • Domain: Peptidase S1
  • Gene: PLMN
DSCQGDSGG3.4.21;Serine endopeptidases. 754
  • Active Site S=Serine at location 760 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 760 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
CQGDSGGP3.4.21;Serine endopeptidases. 756
  • Active Site S=Serine at location 760 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 760 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
GDSGGPL3.4.21;Serine endopeptidases. 758
  • Active Site S=Serine at location 760 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
SGGPLVC3.4.21;Serine endopeptidases. 760
  • Active Site S=Serine at location 760 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
LQGVTSWG3.4.21;Serine endopeptidases. 774
  • Domain: Peptidase S1
GCARPNKPGVY3.4.21.7;Plasmin. 783
  • Domain: Peptidase S1
PNKPGVY3.4.21;Serine endopeptidases. 787
  • Domain: Peptidase S1
PGVYVRVS3.4.21;Serine endopeptidases. 790
  • Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYL
SECKTGNGKNYRGT
MSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKT
MSGLECQ
AWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHT
HNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQS
WSSM
TPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGT
PCQDWA
AQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGM
HFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECF
I
TGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFV
TWIEGVMRNN



DME EC Prediction for this protein is: 3.4.21.7
Check another protein