Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LLLIVPIL1.6.5.3;NADH dehydrogenase (ubiquinone). 7
  • Gene: NU1M
LTERKILG1.6.5.3;NADH dehydrogenase (ubiquinone). 22
  • Gene: NU1M
ERKILGYMQ1.6.5.3;NADH dehydrogenase (ubiquinone). 24
  • Gene: NU1M
LGYMQLRKGP1.6.5.3;NADH dehydrogenase (ubiquinone). 28
  • Gene: NU1M
VGPYGLLQP1.6.5.3;NADH dehydrogenase (ubiquinone). 40
  • Gene: NU1M
KLFTKEP1.6.5.3;NADH dehydrogenase (ubiquinone). 54
  • Gene: NU1M
WTPLPMP1.6.5.3;NADH dehydrogenase (ubiquinone). 86
  • Gene: NU1M
NLGLLFI1.6.5.3;NADH dehydrogenase (ubiquinone). 99
  • Gene: NU1M
SSLAVYSIL1.6.5.3;NADH dehydrogenase (ubiquinone). 109
  • Gene: NU1M
VYSILWSGWASN1.6.5.3;NADH dehydrogenase (ubiquinone). 113
  • Gene: NU1M
ILWSGWASNS1.6.5.3;NADH dehydrogenase (ubiquinone). 116
  • Gene: NU1M
GALRAVAQ1.6.5.3;NADH dehydrogenase (ubiquinone). 131
  • Gene: NU1M
LRAVAQTISYEV1.6.5.3;NADH dehydrogenase (ubiquinone). 133
  • Gene: NU1M
ISYEVTL1.6.5.3;NADH dehydrogenase (ubiquinone). 140
  • Gene: NU1M
TLAIILL1.6.5.3;NADH dehydrogenase (ubiquinone). 145 -
LAIILLS1.6.5.3;NADH dehydrogenase (ubiquinone). 146
  • Gene: NU1M
LLMSGSF1.6.5.3;NADH dehydrogenase (ubiquinone). 154
  • Gene: NU1M
LSTLITTQE1.6.5.3;NADH dehydrogenase (ubiquinone). 162
  • Gene: NU1M
LITTQEH1.6.5.3;NADH dehydrogenase (ubiquinone). 165
  • Gene: NU1M
TQEHLWL1.6.5.3;NADH dehydrogenase (ubiquinone). 168
  • Gene: NU1M
WPLAMMW1.6.5.3;NADH dehydrogenase (ubiquinone). 179
  • Gene: NU1M
STLAETNR1.6.5.3;NADH dehydrogenase (ubiquinone). 188
  • Gene: NU1M
LAETNRTPFD1.6.5.3;NADH dehydrogenase (ubiquinone). 190
  • Gene: NU1M
EGESELVSGFN1.6.5.3;NADH dehydrogenase (ubiquinone). 202
  • Gene: NU1M
GPFALFF1.6.5.3;NADH dehydrogenase (ubiquinone). 218
  • Gene: NU1M
ALFFMAEY1.6.5.3;NADH dehydrogenase (ubiquinone). 221
  • Gene: NU1M
AEYTNII1.6.5.3;NADH dehydrogenase (ubiquinone). 226
  • Gene: NU1M
YPRFRYDQLM1.6.5.3;NADH dehydrogenase (ubiquinone). 277
  • Gene: NU1M
FRYDQLMHLLWK1.6.5.3;NADH dehydrogenase (ubiquinone). 280
  • Gene: NU1M
FLPLTLAL1.6.5.3;NADH dehydrogenase (ubiquinone). 293
  • Gene: NU1M

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNL
GLLFI
LATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDL
A
EGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLAL
LMWYVSMPITISSIPPQT



DME EC Prediction for this protein is: 1.6.5.3
Check another protein