Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
WVGLEMN1.6.5.3;NADH dehydrogenase (ubiquinone). 30
  • Gene: NU2M
PRSTEAA1.6.5.3;NADH dehydrogenase (ubiquinone). 50
  • Gene: NU2M
LTQATAS1.6.5.3;NADH dehydrogenase (ubiquinone). 61
  • Gene: NU2M
TQATASM1.6.5.3;NADH dehydrogenase (ubiquinone). 62
  • Gene: NU2M
PFHFWVPEV1.6.5.3;NADH dehydrogenase (ubiquinone). 110
  • Gene: NU2M
HFWVPEVTQG1.6.5.3;NADH dehydrogenase (ubiquinone). 112
  • Gene: NU2M
TWQKLAP1.6.5.3;NADH dehydrogenase (ubiquinone). 132
  • Gene: NU2M
LTLSILSI1.6.5.3;NADH dehydrogenase (ubiquinone). 155
  • Gene: NU2M
LNQTQLRK1.6.5.3;NADH dehydrogenase (ubiquinone). 170
  • Gene: NU2M
KILAYSSI1.6.5.3;NADH dehydrogenase (ubiquinone). 177
  • Gene: NU2M
LNLTIYI1.6.5.3;NADH dehydrogenase (ubiquinone). 203
  • Gene: NU2M
WNKLTWL1.6.5.3;NADH dehydrogenase (ubiquinone). 234
  • Gene: NU2M
LLSLGGLPP1.6.5.3;NADH dehydrogenase (ubiquinone). 248 -
LSLGGLPPL1.6.5.3;NADH dehydrogenase (ubiquinone). 249 -
GLPPLTGF1.6.5.3;NADH dehydrogenase (ubiquinone). 253 -
LLNLYFY1.6.5.3;NADH dehydrogenase (ubiquinone). 287
  • Gene: NU2M
KMKWQFE1.6.5.3;NADH dehydrogenase (ubiquinone). 312
  • Gene: NU2M

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMM
AMAMKLGMA
PFHFWVPEVTQGTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNM
TI
LNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST
SITLLPMSNNV
KMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL



DME EC Prediction for this protein is: 1.6.5.3
Check another protein