Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PLTWLSK1.6.5.3;NADH dehydrogenase (ubiquinone). 13
  • Gene: NU4M
MIWINTT1.6.5.3;NADH dehydrogenase (ubiquinone). 22
  • Gene: NU4M
TTTHSLII1.6.5.3;NADH dehydrogenase (ubiquinone). 27
  • Gene: NU4M
IPLLFFNQ1.6.5.3;NADH dehydrogenase (ubiquinone). 37
  • Gene: NU4M
WLLPLTIM1.6.5.3;NADH dehydrogenase (ubiquinone). 71
  • Gene: NU4M
RKKLYLSML1.6.5.3;NADH dehydrogenase (ubiquinone). 91
  • Gene: NU4M
LIMTFTA1.6.5.3;NADH dehydrogenase (ubiquinone). 106
  • Gene: NU4M
ELIMFYI1.6.5.3;NADH dehydrogenase (ubiquinone). 114
  • Gene: NU4M
ITRWGNQ1.6.5.3;NADH dehydrogenase (ubiquinone). 133
  • Gene: NU4M
YFLFYTL1.6.5.3;NADH dehydrogenase (ubiquinone). 148
  • Gene: NU4M
LMWLAYTMAFM1.6.5.3;NADH dehydrogenase (ubiquinone). 194
  • Gene: NU4M
VKMPLYG1.6.5.3;NADH dehydrogenase (ubiquinone). 205
  • Gene: NU4M
HLWLPKAHVEAP1.6.5.3;NADH dehydrogenase (ubiquinone). 213
  • Gene: NU4M
LWLPKAHVEAPIAGSM1.6.5.3;NADH dehydrogenase (ubiquinone). 214
  • Gene: NU4M
PIAGSMVLAA1.6.5.3;NADH dehydrogenase (ubiquinone). 224
  • Gene: NU4M
LLKLGGYGM1.6.5.3;NADH dehydrogenase (ubiquinone). 235
  • Gene: NU4M
LRQTDLK1.6.5.3;NADH dehydrogenase (ubiquinone). 277
  • Gene: NU4M
KSLIAYSS1.6.5.3;NADH dehydrogenase (ubiquinone). 283
  • Gene: NU4M
LIQTPWS1.6.5.3;NADH dehydrogenase (ubiquinone). 302
  • Gene: NU4M
LMIAHGL1.6.5.3;NADH dehydrogenase (ubiquinone). 315
  • Gene: NU4M
AHGLTSS1.6.5.3;NADH dehydrogenase (ubiquinone). 318
  • Gene: NU4M
LANSNYE1.6.5.3;NADH dehydrogenase (ubiquinone). 329
  • Gene: NU4M
YERTHSR1.6.5.3;NADH dehydrogenase (ubiquinone). 334
  • Gene: NU4M
QTLLPLM1.6.5.3;NADH dehydrogenase (ubiquinone). 349
  • Gene: NU4M
LLPLMAFWWL1.6.5.3;NADH dehydrogenase (ubiquinone). 351
  • Gene: NU4M
WWLLASL1.6.5.3;NADH dehydrogenase (ubiquinone). 358
  • Gene: NU4M
LANLALPP1.6.5.3;NADH dehydrogenase (ubiquinone). 364
  • Gene: NU4M
NLALPPTINL1.6.5.3;NADH dehydrogenase (ubiquinone). 366
  • Gene: NU4M
TALYSLYM1.6.5.3;NADH dehydrogenase (ubiquinone). 403
  • Gene: NU4M
TRENTLM1.6.5.3;NADH dehydrogenase (ubiquinone). 431
  • Gene: NU4M
LLLSLNP1.6.5.3;NADH dehydrogenase (ubiquinone). 445
  • Gene: NU4M

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLI
SLQIS
LIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYT
MAFMVKMPLYG
LHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSICLRQTDLKSLIAYSSISHMALVVTA
I
LIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNM
LV
TALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS



DME EC Prediction for this protein is: 1.6.5.3
Check another protein