Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GNPVGDKLN1.11.1.6;Catalase. 32
  • Gene: CATA
TVGPRGP1.11.1.6;Catalase. 43 -
RERIPERVVHA1.11.1.6;Catalase. 66
  • Active Site H=Histidine at location 75 on the protein
  • Active Site Description: By similarity.
PERVVHAKG1.11.1.6;Catalase. 70
  • Active Site H=Histidine at location 75 on the protein
  • Active Site Description: By similarity.
GAFGYFEVT1.11.1.6;Catalase. 80
  • Gene: CATA
FEVTHDI1.11.1.6;Catalase. 85 -
RFSTVAG1.11.1.6;Catalase. 112 -
GESGSADT1.11.1.6;Catalase. 118 -
GSADTVRD1.11.1.6;Catalase. 121 -
RDPRGFA1.11.1.6;Catalase. 127 -
GFAVKFYT1.11.1.6;Catalase. 131 -
KFYTEDG1.11.1.6;Catalase. 135
  • Gene: CATA
GNWDLVGNN1.11.1.6;Catalase. 141
  • Active Site N=Asparagine at location 148 on the protein
  • Active Site Description: By similarity.
WDLVGNNTP1.11.1.6;Catalase. 143
  • Active Site N=Asparagine at location 148 on the protein
  • Active Site Description: By similarity.
FIHSQKR1.11.1.6;Catalase. 164 -
KRNPQTH1.11.1.6;Catalase. 169 -
PESLHQV1.11.1.6;Catalase. 190
  • Gene: CATA
NGYGSHT1.11.1.6;Catalase. 213 -
GEAVYCKFHYKTDQGIKNL1.11.1.6;Catalase. 227
  • Gene: CATA
RDLFNAIA1.11.1.6;Catalase. 263
  • Gene: CATA
PSWTFYIQVMTF1.11.1.6;Catalase. 275
  • Gene: CATA
NPFDLTK1.11.1.6;Catalase. 295 -
DLTKVWPH1.11.1.6;Catalase. 298 -
NYFAEVEQ1.11.1.6;Catalase. 324 -
AFDPSNMPPGIE1.11.1.6;Catalase. 333
  • Gene: CATA
SPDKMLQ1.11.1.6;Catalase. 346 -
DKMLQGR1.11.1.6;Catalase. 348 -
LQGRLFAY1.11.1.6;Catalase. 351 -
DTHRHRLG1.11.1.6;Catalase. 360
  • Gene: CATA
RHRLGPNYL1.11.1.6;Catalase. 363 -
PVNCPYR1.11.1.6;Catalase. 374 -
RVANYQRDGPMC1.11.1.6;Catalase. 382
  • Gene: CATA
DNQGGAPNY1.11.1.6;Catalase. 396
  • Gene: CATA
DNVTQVR1.11.1.6;Catalase. 438
  • Gene: CATA
RKRLCENIA1.11.1.6;Catalase. 456
  • Gene: CATA
FIQKKAVKNF1.11.1.6;Catalase. 473
  • Gene: CATA
KPKNAIHT1.11.1.6;Catalase. 504
  • Gene: CATA

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVF
EHIGKKTPIAV
RFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLF
SDRGIPDGHRHM
NGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLT
KVWPH
KDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNY
YPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKY
NAE
KPKNAIHTFVQSGSHLAAREKANL



DME EC Prediction for this protein is: 1.11.1.6
Check another protein