Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RANSFLEE3.4.21;Serine endopeptidases. 42 -
ERECIEE3.4.21;Serine endopeptidases. 56
  • Domain: Gla
GWEGRFC3.4.21.69;Protein C (activated). 125
  • Domain: EGF-like
  • Gene: PROC
LLDSKKKL3.4.21.69;Protein C (activated). 229
  • Domain: Peptidase S1
  • Gene: PROC
WVLTAAH3.4.21;Serine endopeptidases. 247
  • Domain: Peptidase S1
VLTAAHC3.4.21;Serine endopeptidases. 248
  • Active Site H=Histidine at location 253 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
VRLGEYDLRR3.4.21.69;Protein C (activated). 263
  • Domain: Peptidase S1
  • Gene: PROC
DNDIALL3.4.21;Serine endopeptidases. 297
  • Active Site D=Aspartic acid at location 299 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
SQTIVPICLPDSGL3.4.21.69;Protein C (activated). 312
  • Domain: Peptidase S1
  • Gene: PROC
SENMLCAGI3.4.21.69;Protein C (activated). 382
  • Domain: Peptidase S1
  • Gene: PROC
DACEGDSGGP3.4.21;Serine endopeptidases. 396
  • Active Site S=Serine at location 402 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
DACEGDSGGPMV3.4.21.69;Protein C (activated). 396
  • Active Site S=Serine at location 402 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
  • Gene: PROC
GDSGGPMV3.4.21;Serine endopeptidases. 400
  • Active Site S=Serine at location 402 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
YTKVSRY3.4.21;Serine endopeptidases. 435
  • Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHP
CASLCCGHGTCIDGIGSFSCDCRS
GWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVKFPCGRPWKRMEKKRSHLKRD
TEDQEDQVDPRLIDGKMTRRGDSPWQVV
LLDSKKKLACGAVLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALL
HLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEG
DSGGPMV
ASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP



DME EC Prediction for this protein is: 3.4.21.69
Check another protein