Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NGFGRIGR1.2.1;With NAD(+) or NADP(+) as acceptor. 9 -
VAINDPF1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 31
  • Binding Site D=Aspartic acid at location 35 on the protein
  • Binding site description: NAD (By similarity).
YMVYMFQYDSTHGKF1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 42
  • Gene: G3P
GKLVING1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 65 -
ITIFQERDP1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 74
  • Binding Site R=Arginine at location 80 on the protein
  • Binding site description: NAD; via carbonyl oxygen (By s
IKWGDAGA1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 85 -
ESTGVFT1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 97 -
VIISAPS1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 119 -
ISAPSADAPM1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 121
  • Binding Site S=Serine at location 122 on the protein
  • Binding site description: NAD; via carbonyl oxygen.
DAPMFVMGVN1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 127 -
GVNHEKY1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 134 -
SNASCTT1.2.1;With NAD(+) or NADP(+) as acceptor. 148
  • Active Site C=Cysteine at location 152 on the protein
  • Active Site Description: Nucleophile (By similarity).
  • Binding Site C=Cysteine at location 152 on the protein
  • Binding site description: Substrate (Potential).
SNASCTTNCLAPL1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 148
  • Active Site C=Cysteine at location 152 on the protein
  • Active Site Description: Nucleophile (By similarity).
CTTNCLAP1.2.1;With NAD(+) or NADP(+) as acceptor. 152
  • Active Site C=Cysteine at location 152 on the protein
  • Active Site Description: Nucleophile (By similarity).
LAKVIHD1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 160 -
IVEGLMT1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 170 -
EGLMTTVH1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 172 -
GLMTTVH1.2.1;With NAD(+) or NADP(+) as acceptor. 173 -
TATQKTV1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 182
  • Binding Site T=Threonine at location 182 on the protein
  • Binding site description: Glyceraldehyde 3-phosphate (By
KTVDGPS1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 186 -
WRDGRGA1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 196 -
NIIPASTGAAKAV1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 205 -
TGAAKAVG1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 211 -
AKAVGKV1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 214 -
KAVGKVIP1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 215 -
PELNGKL1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 222 -
LNGKLTG1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 224 -
GKLTGMAFRVP1.2.1;With NAD(+) or NADP(+) as acceptor. 226
  • Binding Site R=Arginine at location 234 on the protein
  • Binding site description: Glyceraldehyde 3-phosphate (By
RVPTANVS1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 234
  • Binding Site R=Arginine at location 234 on the protein
  • Binding site description: Glyceraldehyde 3-phosphate (By
NVSVVDLT1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 239 -
VSVVDLT1.2.1;With NAD(+) or NADP(+) as acceptor. 240 -
AKYDDIK1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 253 -
ASEGPLKG1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 265 -
GPLKGIL1.2.1;With NAD(+) or NADP(+) as acceptor. 268 -
LKGILGY1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 270 -
AGIALND1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 299 -
LNDHFVKL1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 303 -
FVKLISWYDNE1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 307
  • Binding Site N=Asparagine at location 316 on the protein
  • Binding site description: NAD (By similarity).
SWYDNEFGYS1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 312
  • Binding Site N=Asparagine at location 316 on the protein
  • Binding site description: NAD (By similarity).
GYSNRVV1.2.1.12;Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). 319 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTG
VFT
TMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGR
GA
LQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVV
DLMAHMASKE



DME EC Prediction for this protein is: 1.2.1.12
Check another protein