Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PLQRLRIVRGTQLFED2.7.10.1;Receptor protein-tyrosine kinase. 95
  • Gene: ERBB2
YALAVLDN2.7.10.1;Receptor protein-tyrosine kinase. 112
  • Gene: ERBB2
GLRELQLRSLTEILKGGVLI2.7.10.1;Receptor protein-tyrosine kinase. 136
  • Gene: ERBB2
QCAAGCTGP2.7.10.1;Receptor protein-tyrosine kinase. 239 -
TYNTDTFESM2.7.10.1;Receptor protein-tyrosine kinase. 273
  • Gene: ERBB2
CPYNYLST2.7.10.1;Receptor protein-tyrosine kinase. 299
  • Gene: ERBB2
LQVFETLEEITGYLYISAWP2.7.10.1;Receptor protein-tyrosine kinase. 397
  • Gene: ERBB2
FLRGQECV2.7.10.1;Receptor protein-tyrosine kinase. 534
  • Gene: ERBB2
CQPCPINCTHSC2.7.10.1;Receptor protein-tyrosine kinase. 623
  • Gene: ERBB2
GCPAEQRASP2.7.10.1;Receptor protein-tyrosine kinase. 641
  • Gene: ERBB2
ELVEPLTPSG2.7.10.1;Receptor protein-tyrosine kinase. 695 -
KETELRK2.7.10.1;Receptor protein-tyrosine kinase. 716 -
VKIPVAIK2.7.10.1;Receptor protein-tyrosine kinase. 746
  • Domain: Protein kinase
LDEAYVMA2.7.10.1;Receptor protein-tyrosine kinase. 768
  • Domain: Protein kinase
RLLGICLTS2.7.10.1;Receptor protein-tyrosine kinase. 784
  • Domain: Protein kinase
TQLMPYGCLLD2.7.10.1;Receptor protein-tyrosine kinase. 798
  • Domain: Protein kinase
RGRLGSQDLLNWC2.7.10.1;Receptor protein-tyrosine kinase. 814
  • Domain: Protein kinase
  • Gene: ERBB2
RLVHRDLAARNVLVKSPNHVKITDFGLARLL2.7.10.1;Receptor protein-tyrosine kinase. 840
  • Active Site D=Aspartic acid at location 845 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 844
  • Active Site D=Aspartic acid at location 845 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLV2.7.10;Protein-tyrosine kinases. 847
  • Domain: Protein kinase
GGKVPIKW2.7.10.1;Receptor protein-tyrosine kinase. 881
  • Domain: Protein kinase
SDVWSYGVT2.7.10;Protein-tyrosine kinases. 903
  • Domain: Protein kinase
YGVTVWE2.7.10.1;Receptor protein-tyrosine kinase. 908
  • Domain: Protein kinase
KPYDGIP2.7.10.1;Receptor protein-tyrosine kinase. 921
  • Domain: Protein kinase
GERLPQP2.7.10;Protein-tyrosine kinases. 938
  • Domain: Protein kinase
GERLPQPPICTI2.7.10.1;Receptor protein-tyrosine kinase. 938
  • Domain: Protein kinase
MVKCWMID2.7.10.1;Receptor protein-tyrosine kinase. 955
  • Domain: Protein kinase
RPRFRELV2.7.10.1;Receptor protein-tyrosine kinase. 966
  • Domain: Protein kinase
MARDPQR2.7.10.1;Receptor protein-tyrosine kinase. 979
  • Domain: Protein kinase
DSTFYRSLLEDDDMG2.7.10.1;Receptor protein-tyrosine kinase. 1001
  • Gene: ERBB2
LVDAEEYLVPQQGFF2.7.10.1;Receptor protein-tyrosine kinase. 1017
  • Gene: ERBB2
SPLQRYSEDPT2.7.10.1;Receptor protein-tyrosine kinase. 1107
  • Gene: ERBB2
ETDGYVAPL2.7.10.1;Receptor protein-tyrosine kinase. 1123
  • Gene: ERBB2
RPAGATLERPKTLSP2.7.10.1;Receptor protein-tyrosine kinase. 1161
  • Gene: ERBB2
AENPEYL2.7.10.1;Receptor protein-tyrosine kinase. 1243 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLR
IVRGTQLFED
NYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCK
GSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHE
QCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLST
DVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVF
ETLEEITGYLYISAWP
DSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRP
EDECVGEGLACHQLCARGHCWGPGPTQCVNCSQ
FLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGA
CQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPL
TPSG
AMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQL
MPYGCLLD
HVRENRGRLGSQDLLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQ
SDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPL
DSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAAKGLQS
LPTHDP
SPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQ
GGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPT
AENPEYLGLDVPV



DME EC Prediction for this protein is: 2.7.10.1
Check another protein