Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
HHWCIPF2.7.10.1;Receptor protein-tyrosine kinase. 297
  • Domain: Ig-like C2-type
PTHVNNGNYTL2.7.10.1;Receptor protein-tyrosine kinase. 351
  • Domain: Ig-like C2-type
  • Gene: NTRK1
AVLAPEDGLAMSLHFMTLG2.7.10.1;Receptor protein-tyrosine kinase. 454
  • Gene: NTRK1
RRDIVLK2.7.10.1;Receptor protein-tyrosine kinase. 507 -
ELGEGAFGKVFLAEC2.7.10.1;Receptor protein-tyrosine kinase. 515
  • Domain: Protein kinase
YMRHGDL2.7.10;Protein-tyrosine kinases. 591
  • Domain: Protein kinase
HGDLNRFLRSHGPDAK2.7.10.1;Receptor protein-tyrosine kinase. 594
  • Domain: Protein kinase
  • Gene: NTRK1
FVHRDLA2.7.10;Protein-tyrosine kinases. 646
  • Active Site D=Aspartic acid at location 650 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
FVHRDLATRNC2.7.10.1;Receptor protein-tyrosine kinase. 646
  • Active Site D=Aspartic acid at location 650 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
HRDLATRN2.7.10;Protein-tyrosine kinases. 648
  • Active Site D=Aspartic acid at location 650 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RWMPPESI2.7.10.1;Receptor protein-tyrosine kinase. 692
  • Domain: Protein kinase
GVVLWEI2.7.10.1;Receptor protein-tyrosine kinase. 714
  • Domain: Protein kinase
FTYGKQPW2.7.10.1;Receptor protein-tyrosine kinase. 721
  • Domain: Protein kinase
CWQREPQQR2.7.10.1;Receptor protein-tyrosine kinase. 763
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLHHLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVK
SGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQGPLAHMPNASCGVPTLKVQV
PNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMKSGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEM
HHWC
IPF
SVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDT
NSTSGDPVEKKDETPFGVSVAVGLAVFACLFLSTLLLVLNKCGRRNKFGINRP
AVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIENPQYFSDA
CVHHIK
RRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAK
LLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESIL
YRKFTTESDVWSF
GVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG



DME EC Prediction for this protein is: 2.7.10.1
Check another protein