Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
LTLGKNPH1.14.14.1;Unspecific monooxygenase. 53 -
YGDVLQI1.14.14.1;Unspecific monooxygenase. 70 -
VLSGLDTIRQALV1.14.14.1;Unspecific monooxygenase. 85 -
QGDDFKGRP1.14.14.1;Unspecific monooxygenase. 99 -
WAARRRLAQ1.14.14.1;Unspecific monooxygenase. 131 -
FSIASDP1.14.14.1;Unspecific monooxygenase. 145 -
NVICAICFG1.14.14.1;Unspecific monooxygenase. 196 -
VVGSGNPADFIP1.14.14.1;Unspecific monooxygenase. 227 -
SGNPADFIPIL1.14.14.1;Unspecific monooxygenase. 230 -
PILRYLP1.14.14.1;Unspecific monooxygenase. 238 -
KEHYKTFEKG1.14.14.1;Unspecific monooxygenase. 267
  • Gene: CP1A1
IRDITDSLI1.14.14.1;Unspecific monooxygenase. 278 -
LDENANVQ1.14.14.1;Unspecific monooxygenase. 294
  • Gene: CP1A1
QLSDEKI1.14.14.1;Unspecific monooxygenase. 301
  • Gene: CP1A1
FGAGFDT1.14.14.1;Unspecific monooxygenase. 315 -
TTAISWSL1.14.14.1;Unspecific monooxygenase. 323 -
ELDTVIG1.14.14.1;Unspecific monooxygenase. 346 -
RRPRLSDR1.14.14.1;Unspecific monooxygenase. 355 -
LPYMEAFILE1.14.14.1;Unspecific monooxygenase. 365 -
PFTIPHST1.14.14.1;Unspecific monooxygenase. 383 -
PHSTTRDT1.14.14.1;Unspecific monooxygenase. 387 -
CVFVNQWQ1.14.14.1;Unspecific monooxygenase. 406 -
NQWQINH1.14.14.1;Unspecific monooxygenase. 410 -
EVFLFLA1.14.14.1;Unspecific monooxygenase. 466 -
TPIYGLT1.14.14.1;Unspecific monooxygenase. 491 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLFPISMSATEFLLASVIFCLVFWVIRASRPQVPKGLKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQQYGDVLQIRIGSTPVVVLSGLDTIRQALVRQG
DDFKGRP
DLYTFTLISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICA
ICFG
RRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
QLSDEKI
INIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFY
IPKGR
CVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAILLQRVEFSVPLGVKVDMTPIYGLTMKH
ACCEHFQMQLRS



DME EC Prediction for this protein is: 1.14.14.1
Check another protein