Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GILAADES4.1.2.13;Fructose-bisphosphate aldolase. 29 -
ENTEENRR4.1.2.13;Fructose-bisphosphate aldolase. 50
  • Binding Site R=Arginine at location 56 on the protein
  • Binding site description: Substrate (By similarity).
GVILFHET4.1.2.13;Fructose-bisphosphate aldolase. 76 -
FHETLYQK4.1.2.13;Fructose-bisphosphate aldolase. 80 -
GIVVGIK4.1.2.13;Fructose-bisphosphate aldolase. 102 -
APLAGTNKETT4.1.2.13;Fructose-bisphosphate aldolase. 114
  • Gene: ALDOB
ETTIQGLD4.1.2.13;Fructose-bisphosphate aldolase. 122
  • Gene: ALDOB
RCAQYKKDG4.1.2.13;Fructose-bisphosphate aldolase. 134 -
LAIQENAN4.1.2.13;Fructose-bisphosphate aldolase. 162
  • Gene: ALDOB
LARYASI4.1.2.13;Fructose-bisphosphate aldolase. 171 -
VPIVEPE4.1.2.13;Fructose-bisphosphate aldolase. 184
  • Active Site E=Glutamic acid at location 188 on the protein
  • Active Site Description: Proton acceptor (By similarity
PDGDHDL4.1.2.13;Fructose-bisphosphate aldolase. 193 -
CQYVTEKVLAA4.1.2.13;Fructose-bisphosphate aldolase. 202 -
VLAAVYKAL4.1.2.13;Fructose-bisphosphate aldolase. 209 -
YKALNDHHV4.1.2.13;Fructose-bisphosphate aldolase. 214 -
DHHVYLEGTLLKPNM4.1.2.13;Fructose-bisphosphate aldolase. 219
  • Active Site K=Lysine at location 230 on the protein
  • Active Site Description: Schiff-base intermediate with
LEGTLLKPNMVT4.1.2.13;Fructose-bisphosphate aldolase. 224
  • Active Site K=Lysine at location 230 on the protein
  • Active Site Description: Schiff-base intermediate with
RTVPAAVP4.1.2.13;Fructose-bisphosphate aldolase. 259 -
VPAAVPGI4.1.2.13;Fructose-bisphosphate aldolase. 261 -
ATLNLNA4.1.2.13;Fructose-bisphosphate aldolase. 280 -
FSYGRALQAS4.1.2.13;Fructose-bisphosphate aldolase. 300
  • Binding Site R=Arginine at location 304 on the protein
  • Binding site description: Substrate.
TQEAFMKRA4.1.2.13;Fructose-bisphosphate aldolase. 324
  • Gene: ALDOB
QAAKGQYVH4.1.2.13;Fructose-bisphosphate aldolase. 337
  • Gene: ALDOB
GQYVHTGSSGAA4.1.2.13;Fructose-bisphosphate aldolase. 341
  • Gene: ALDOB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKE
K
GIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIVEPEVIPDGDHDLE
H
CQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHACTKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
SYGRALQAS
ALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTACYTY



DME EC Prediction for this protein is: 4.1.2.13
Check another protein