Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
KTFPTVNP1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 52 -
GDKEDVD1.2.1;With NAD(+) or NADP(+) as acceptor. 71 -
DVDKAVKAA1.2.1;With NAD(+) or NADP(+) as acceptor. 75 -
LGSPWRRMDAS1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 89 -
RGRLLNRLADL1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 101 -
LADLIERD1.2.1;With NAD(+) or NADP(+) as acceptor. 108 -
ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGD1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 133
  • Gene: ALDH2
RYYAGWADK1.2.1;With NAD(+) or NADP(+) as acceptor. 147 -
QIIPWNFP1.2.1;With NAD(+) or NADP(+) as acceptor. 181 -
PWNFPLLM1.2.1;With NAD(+) or NADP(+) as acceptor. 184 -
WKLGPAL1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 194 -
VVMKVAEQTPL1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 206 -
EAGFPPGV1.2.1;With NAD(+) or NADP(+) as acceptor. 227 -
GVVNIVPG1.2.1;With NAD(+) or NADP(+) as acceptor. 233 -
GPTAGAAI1.2.1;With NAD(+) or NADP(+) as acceptor. 242 -
GAAIASH1.2.1;With NAD(+) or NADP(+) as acceptor. 246 -
DVDKVAFTGSTE1.2.1;With NAD(+) or NADP(+) as acceptor. 254 -
VTLELGG1.2.1;With NAD(+) or NADP(+) as acceptor. 282
  • Active Site E=Glutamic acid at location 285 on the protein
  • Active Site Description: Proton acceptor (By similarity
TLELGGK1.2.1;With NAD(+) or NADP(+) as acceptor. 283
  • Active Site E=Glutamic acid at location 285 on the protein
  • Active Site Description: Proton acceptor (By similarity
SDADMDWAVEQAHFALFFNQGQCC1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 296
  • Gene: ALDH2
FFNQGQCC1.2.1;With NAD(+) or NADP(+) as acceptor. 312 -
AGSRTFV1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 321 -
EFVERSVARA1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 334
  • Gene: ALDH2
GPQVDETQ1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 359 -
EGAKLLCGG1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 380 -
PTVFGDVQDGM1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 400 -
YGLAAAVFT1.2.1;With NAD(+) or NADP(+) as acceptor. 442 -
YGLAAAVFTKDLDKANYLSQALQAGTVW1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 442
  • Gene: ALDH2
FTKDLDKA1.2.1;With NAD(+) or NADP(+) as acceptor. 449 -
QALQAGTVWVN1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 461 -
ALQAGTVW1.2.1;With NAD(+) or NADP(+) as acceptor. 462 -
NCYDVFGAQSPFGGYK1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 471
  • Gene: ALDH2
AQSPFGG1.2.1;With NAD(+) or NADP(+) as acceptor. 478 -
PFGGYKMSG1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 481 -
AYTEVKTVT1.2.1.3;Aldehyde dehydrogenase (NAD(+)). 501 -
YTEVKTVT1.2.1;With NAD(+) or NADP(+) as acceptor. 502 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASH
RGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPAL
ATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCC
CAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQP
TVFGDVQDGM
TIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQ
AYTEVKTVTVKVPQKNS



DME EC Prediction for this protein is: 1.2.1.3
Check another protein