Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DQSFPGF3.1.1.8;Cholinesterase. 98
  • Gene: CHLE
GSEMWNPN3.1.1;Carboxylic ester hydrolases. 106 -
LSEDCLYLNVW3.1.1;Carboxylic ester hydrolases. 116 -
PKPKNATV3.1.1.8;Cholinesterase. 130
  • Gene: CHLE
WIYGGGF3.1.1;Carboxylic ester hydrolases. 140 -
FQTGTSSL3.1.1.8;Cholinesterase. 146
  • Gene: CHLE
VYDGKFL3.1.1.8;Cholinesterase. 155
  • Gene: CHLE
VSMNYRVG3.1.1;Carboxylic ester hydrolases. 170 -
NYRVGALGFLALPGNPEAPGN3.1.1.8;Cholinesterase. 173
  • Gene: CHLE
GFLALPG3.1.1;Carboxylic ester hydrolases. 180 -
LALQWVQ3.1.1;Carboxylic ester hydrolases. 201 -
NIAAFGG3.1.1;Carboxylic ester hydrolases. 209 -
FGESAGA3.1.1;Carboxylic ester hydrolases. 223
  • Active Site S=Serine at location 226 on the protein
  • Active Site Description: Acyl-ester intermediate (By si
TEIIKCLRNKD3.1.1.8;Cholinesterase. 286
  • Gene: CHLE
NFGPTVDGDFLTDMP3.1.1.8;Cholinesterase. 317
  • Gene: CHLE
QILVGVNKDEGTAFLVYGAPGFSKDN3.1.1.8;Cholinesterase. 344
  • Active Site E=Glutamic acid at location 353 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: CHLE
GVNKDEG3.1.1;Carboxylic ester hydrolases. 348
  • Active Site E=Glutamic acid at location 353 on the protein
  • Active Site Description: Charge relay system (By simila
YGAPGFSKD3.1.1;Carboxylic ester hydrolases. 360 -
ITRKEFQEGL3.1.1.8;Cholinesterase. 373
  • Gene: CHLE
FPGVSEFG3.1.1.8;Cholinesterase. 386
  • Gene: CHLE
AFFYYFEHRS3.1.1.8;Cholinesterase. 444
  • Gene: CHLE
WPEWMGV3.1.1;Carboxylic ester hydrolases. 458 -
HGYEIEF3.1.1;Carboxylic ester hydrolases. 466
  • Active Site H=Histidine at location 466 on the protein
  • Active Site Description: Charge relay system (By simila
QKYLTLN3.1.1.8;Cholinesterase. 526
  • Gene: CHLE
TKLRAQQCRFWT3.1.1.8;Cholinesterase. 540
  • Gene: CHLE
EWKAGFHRW3.1.1.8;Cholinesterase. 570
  • Gene: CHLE
FNDYTSKKE3.1.1.8;Cholinesterase. 589
  • Gene: CHLE

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIPYAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQS
FPGF
HGSEMWNPNTDLSEDCLYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
LALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSV
NFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVYGAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFH
YTDWVDDQRPENYREALGDVVGDYNFICPALEFTKKFSEWGNN
AFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLERRDNYTKAEEILSRSIVKRWA
NFAKYGNPNETQNNSTSWPVFKSTE
QKYLTLNTESTRIMTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL



DME EC Prediction for this protein is: 3.1.1.8
Check another protein