Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PDLSKHNN2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 21 -
HNNHMAK2.7.3.2;Creatine kinase. 26 -
DDVIQTGVDNPGHP2.7.3.2;Creatine kinase. 54 -
DNPGHPFI2.7.3.2;Creatine kinase. 62 -
VAGDEESY2.7.3.2;Creatine kinase. 75 -
AGDEESY2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 76 -
DRHGGYKP2.7.3.2;Creatine kinase. 95 -
GGDDLDP2.7.3.2;Creatine kinase. 117 -
YVLSSRVRTGRSI2.7.3.2;Creatine kinase. 125 -
LPPHCSRGERR2.7.3.2;Creatine kinase. 142 -
QQQLIDDHFLF2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 184
  • Binding Site H=Histidine at location 191 on the protein
  • Binding site description: ATP (By similarity).
LIDDHFLFDKPVSPLL2.7.3.2;Creatine kinase. 187
  • Binding Site H=Histidine at location 191 on the protein
  • Binding site description: ATP (By similarity).
GMARDWPDARGIWHN2.7.3.2;Creatine kinase. 206 -
DARGIWHN2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 213 -
DARGIWHNDNK2.7.3.2;Creatine kinase. 213 -
FLVWVNEEDH2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 225
  • Binding Site E=Glutamic acid at location 232 on the protein
  • Binding site description: Substrate (By similarity).
NEEDHLR2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 230
  • Binding Site E=Glutamic acid at location 232 on the protein
  • Binding site description: Substrate (By similarity).
NEEDHLRVI2.7.3.2;Creatine kinase. 230
  • Binding Site R=Arginine at location 236 on the protein
  • Binding site description: ATP (By similarity).
RVISMEK2.7.3.2;Creatine kinase. 236
  • Binding Site R=Arginine at location 236 on the protein
  • Binding site description: ATP (By similarity).
KGGNMKEVFRRFCVGL2.7.3.2;Creatine kinase. 242
  • Gene: KCRM
KIEEIFKKAGHPFMW2.7.3.2;Creatine kinase. 259
  • Gene: KCRM
LTCPSNLGTGLR2.7.3.2;Creatine kinase. 281 -
CPSNLGT2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 283
  • Binding Site C=Cysteine at location 283 on the protein
  • Binding site description: Substrate (By similarity).
RLQKRGTGGVDT2.7.3.2;Creatine kinase. 316 -
DRLGSSEV2.7.3;Phosphotransferases with a nitrogenous group as acceptor. 340 -
VVDGVKLMVEMEK2.7.3.2;Creatine kinase. 353
  • Gene: KCRM

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGY
KP
TDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSP
LL
LASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRL
RLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK



DME EC Prediction for this protein is: 2.7.3.2
Check another protein