Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DIESKFA3.1.1.34;Lipoprotein lipase. 36
  • Gene: LIPL
CHFNHSSKTF3.1.1.34;Lipoprotein lipase. 67
  • Gene: LIPL
NVIVVDW3.1.1.34;Lipoprotein lipase. 107 -
VDWLSRA3.1.1;Carboxylic ester hydrolases. 111 -
SAGYTKLVG3.1.1.34;Lipoprotein lipase. 124
  • Gene: LIPL
DVARFINW3.1.1.34;Lipoprotein lipase. 134
  • Gene: LIPL
NVHLLGYSLGAHAAGIAGSLT3.1.1.34;Lipoprotein lipase. 152
  • Active Site S=Serine at location 159 on the protein
  • Active Site Description: Nucleophile (By similarity).
  • Gene: LIPL
RITGLDPAGPNFEYAEA3.1.1.34;Lipoprotein lipase. 178
  • Active Site D=Aspartic acid at location 183 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: LIPL
GLDPAGP3.1.1;Carboxylic ester hydrolases. 181
  • Active Site D=Aspartic acid at location 183 on the protein
  • Active Site Description: Charge relay system (By simila
RLSPDDA3.1.1;Carboxylic ester hydrolases. 197 -
FVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG3.1.1.34;Lipoprotein lipase. 205
  • Gene: LIPL
RVIAERGLGDVDQLVKCSHERS3.1.1.34;Lipoprotein lipase. 250
  • Active Site H=Histidine at location 268 on the protein
  • Active Site Description: Charge relay system (By simila
  • Gene: LIPL
KCSHERS3.1.1;Carboxylic ester hydrolases. 265
  • Active Site H=Histidine at location 268 on the protein
  • Active Site Description: Charge relay system (By simila
HLFIDSL3.1.1;Carboxylic ester hydrolases. 273 -
CLSCRKNRCN3.1.1;Carboxylic ester hydrolases. 302 -
KMYLKTR3.1.1;Carboxylic ester hydrolases. 327 -
QMPYKVFHYQVK3.1.1.34;Lipoprotein lipase. 335
  • Gene: LIPL
FEISLYGTVAESENIPFTLPE3.1.1.34;Lipoprotein lipase. 362
  • Domain: PLAT
  • Gene: LIPL
NKTYSFL3.1.1;Carboxylic ester hydrolases. 386
  • Domain: PLAT
YTEVDIGELLMLKLKW3.1.1.34;Lipoprotein lipase. 394
  • Domain: PLAT
  • Gene: LIPL
WSDWWSSP3.1.1.34;Lipoprotein lipase. 417
  • Domain: PLAT
  • Gene: LIPL
KIRVKAG3.1.1;Carboxylic ester hydrolases. 430
  • Domain: PLAT
IRVKAGETQKKVIFC3.1.1.34;Lipoprotein lipase. 431
  • Domain: PLAT
  • Gene: LIPL
VKAGETQ3.1.1;Carboxylic ester hydrolases. 433
  • Domain: PLAT
SHLQKGK3.1.1.34;Lipoprotein lipase. 451
  • Domain: PLAT
  • Gene: LIPL

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALY
KREPDS
NVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSP
DDA
DFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
L
CLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIG
ELLMLKLKW
KSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG



DME EC Prediction for this protein is: 3.1.1.34
Check another protein