Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SVENYTLTIND3.2.1.52;Beta-N-acetylhexosaminidase. 112
  • Gene: HEXA
LRGLETFSQL3.2.1.52;Beta-N-acetylhexosaminidase. 136 -
PRFPHRG3.2.1.52;Beta-N-acetylhexosaminidase. 165 -
DTSRHYLP3.2.1.52;Beta-N-acetylhexosaminidase. 175 -
LPLSSIL3.2.1;Glycosidases 181 -
SFPYESFTFPEL3.2.1.52;Beta-N-acetylhexosaminidase. 210
  • Gene: HEXA
ARLRGIRV3.2.1.52;Beta-N-acetylhexosaminidase. 246 -
EFDTPGHTLSWG3.2.1.52;Beta-N-acetylhexosaminidase. 256 -
PGLLTPCYSGS3.2.1.52;Beta-N-acetylhexosaminidase. 271
  • Gene: HEXA
HLGGDEV3.2.1.52;Beta-N-acetylhexosaminidase. 318
  • Active Site E=Glutamic acid at location 323 on the protein
  • Active Site Description: Proton donor (By similarity).
LESFYIQTLLDIVS3.2.1.52;Beta-N-acetylhexosaminidase. 351
  • Gene: HEXA
PDTIIQVWRE3.2.1.52;Beta-N-acetylhexosaminidase. 385
  • Gene: HEXA
LSAPWYL3.2.1.52;Beta-N-acetylhexosaminidase. 416 -
PRLWPRA3.2.1.52;Beta-N-acetylhexosaminidase. 471 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVV
TPGCNQLPTLE
SVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNV
FHWHLVDDP
SFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF
MSTFFLEVSSVFPDFYL
HLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNY
MKELELVTKAGFRAL
LSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERL
SHFRCELLRRGVQAQPLNVGFCEQEFEQT



DME EC Prediction for this protein is: 3.2.1.52
Check another protein