Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NKITVVGVG1.1.1.27;L-lactate dehydrogenase. 22 -
VGVGQVGMA1.1.1.27;L-lactate dehydrogenase. 27 -
ACAISIL1.1.1.27;L-lactate dehydrogenase. 35 -
DELALVDV1.1.1.27;L-lactate dehydrogenase. 47 -
EDKLKGE1.1.1.27;L-lactate dehydrogenase. 56 -
MDLQHGS1.1.1.27;L-lactate dehydrogenase. 64 -
DLQHGSLFL1.1.1.27;L-lactate dehydrogenase. 65 -
KDYSVTA1.1.1.27;L-lactate dehydrogenase. 82 -
SKIVVVT1.1.1;With NAD(+) or NADP(+) as acceptor. 90 -
VTAGVRQ1.1.1.27;L-lactate dehydrogenase. 95
  • Binding Site R=Arginine at location 100 on the protein
  • Binding site description: NAD (By similarity).
IIPQIVKYSP1.1.1.27;L-lactate dehydrogenase. 121 -
VVSNPVD1.1.1;With NAD(+) or NADP(+) as acceptor. 136
  • Binding Site N=Asparagine at location 139 on the protein
  • Binding site description: NAD or substrate (By similarit
VVSNPVDI1.1.1.27;L-lactate dehydrogenase. 136
  • Binding Site N=Asparagine at location 139 on the protein
  • Binding site description: NAD or substrate (By similarit
NPVDILT1.1.1.27;L-lactate dehydrogenase. 139
  • Binding Site N=Asparagine at location 139 on the protein
  • Binding site description: NAD or substrate (By similarit
LTYVTWKLSGLP1.1.1.27;L-lactate dehydrogenase. 144 -
WKLSGLP1.1.1;With NAD(+) or NADP(+) as acceptor. 149 -
PKHRVIG1.1.1;With NAD(+) or NADP(+) as acceptor. 155 -
IGSGCNLD1.1.1.27;L-lactate dehydrogenase. 160 -
NLDSARFR1.1.1.27;L-lactate dehydrogenase. 165
  • Binding Site R=Arginine at location 170 on the protein
  • Binding site description: Substrate (By similarity).
LDSARFR1.1.1;With NAD(+) or NADP(+) as acceptor. 166
  • Binding Site R=Arginine at location 170 on the protein
  • Binding site description: Substrate (By similarity).
ARFRYLM1.1.1.27;L-lactate dehydrogenase. 169
  • Binding Site R=Arginine at location 170 on the protein
  • Binding site description: Substrate (By similarity).
EKLGIHPS1.1.1.27;L-lactate dehydrogenase. 177 -
SCHGWILGEHGDS1.1.1.27;L-lactate dehydrogenase. 185
  • Active Site H=Histidine at location 194 on the protein
  • Active Site Description: Proton acceptor (By similarity
ILGEHGD1.1.1;With NAD(+) or NADP(+) as acceptor. 190
  • Active Site H=Histidine at location 194 on the protein
  • Active Site Description: Proton acceptor (By similarity
GEHGDSSV1.1.1.27;L-lactate dehydrogenase. 192
  • Active Site H=Histidine at location 194 on the protein
  • Active Site Description: Proton acceptor (By similarity
WSGVNVAGV1.1.1.27;L-lactate dehydrogenase. 202 -
GVNVAGV1.1.1;With NAD(+) or NADP(+) as acceptor. 204 -
DSENWKE1.1.1.27;L-lactate dehydrogenase. 224 -
VVESAYE1.1.1.27;L-lactate dehydrogenase. 235 -
IKLKGYT1.1.1.27;L-lactate dehydrogenase. 243 -
LKGYTNWAIG1.1.1.27;L-lactate dehydrogenase. 245
  • Binding Site T=Threonine at location 249 on the protein
  • Binding site description: Substrate (By similarity).
WAIGLSV1.1.1.27;L-lactate dehydrogenase. 251 -
STMVKGM1.1.1.27;L-lactate dehydrogenase. 275 -
GMYGIENEVFLSLPC1.1.1.27;L-lactate dehydrogenase. 280
  • Gene: LDHB
GLTSVINQKLKD1.1.1.27;L-lactate dehydrogenase. 300 -
QKLKDDEV1.1.1.27;L-lactate dehydrogenase. 307 -
KSADTLW1.1.1.27;L-lactate dehydrogenase. 319 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVR
Q
QEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVA
V
WSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDDEV
AQLKKSADTLWDIQKDLKDL



DME EC Prediction for this protein is: 1.1.1.27
Check another protein