Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
IHLYVKDPA2.7.10.1;Receptor protein-tyrosine kinase. 97
  • Domain: Ig-like C2-type
VKDPARP2.7.10.1;Receptor protein-tyrosine kinase. 101 -
YSCVASN2.7.10.1;Receptor protein-tyrosine kinase. 276
  • Domain: Ig-like C2-type
NWTYLGPF2.7.10.1;Receptor protein-tyrosine kinase. 335
  • Domain: Ig-like C2-type
HTDRCDE2.7.10.1;Receptor protein-tyrosine kinase. 437
  • Domain: Ig-like C2-type
YKYKQKP2.7.10.1;Receptor protein-tyrosine kinase. 538 -
IDPTQLPY2.7.10.1;Receptor protein-tyrosine kinase. 564 -
GAFGKVVEATA2.7.10.1;Receptor protein-tyrosine kinase. 591
  • Domain: Protein kinase
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 613
  • Binding Site K=Lysine at location 616 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ALMSELK2.7.10.1;Receptor protein-tyrosine kinase. 629
  • Domain: Protein kinase
NIVNLLGACT2.7.10.1;Receptor protein-tyrosine kinase. 645
  • Domain: Protein kinase
GGPVLVITEYC2.7.10.1;Receptor protein-tyrosine kinase. 656
  • Domain: Protein kinase
EYCCYGDLLN2.7.10.1;Receptor protein-tyrosine kinase. 664
  • Domain: Protein kinase
AEAMLGPSLS2.7.10.1;Receptor protein-tyrosine kinase. 679
  • Domain: Protein kinase
YKNIHLEKKYVRRDS2.7.10.1;Receptor protein-tyrosine kinase. 699
  • Domain: Protein kinase
FSSQVAQG2.7.10.1;Receptor protein-tyrosine kinase. 758
  • Domain: Protein kinase
NCIHRDVAARNVLLT2.7.10.1;Receptor protein-tyrosine kinase. 773
  • Active Site D=Aspartic acid at location 778 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
AARNVLL2.7.10;Protein-tyrosine kinases. 780
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 796
  • Domain: Protein kinase
KGNARLP2.7.10.1;Receptor protein-tyrosine kinase. 812
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 817
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 818
  • Domain: Protein kinase
KWMAPESIF2.7.10.1;Receptor protein-tyrosine kinase. 820
  • Domain: Protein kinase
CVYTVQSDVWSYG2.7.10.1;Receptor protein-tyrosine kinase. 830
  • Domain: Protein kinase
SDVWSYGI2.7.10;Protein-tyrosine kinases. 836
  • Domain: Protein kinase
GILLWEIF2.7.10.1;Receptor protein-tyrosine kinase. 842
  • Domain: Protein kinase
WEIFSLG2.7.10.1;Receptor protein-tyrosine kinase. 846
  • Domain: Protein kinase
KFYKLVKDGYQMAQP2.7.10.1;Receptor protein-tyrosine kinase. 864
  • Domain: Protein kinase
FAPKNIYSIMQ2.7.10.1;Receptor protein-tyrosine kinase. 880
  • Domain: Protein kinase

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGPGVLLLLLVATAWHGQGIPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLY
VKDPARP
WNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIP
GPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGN
YSCVASNVQGKHSTSMFFRVVESAY
LNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGF
NWTYLGPFSDHQPEPKLANATTKDTYRHTFTLSLPRLKPSEAGRYSFLARNPGGWRALTFELTLRY
PPEVSVIWTFINGSGTLLCAASGYPQPNVTWLQCSG
HTDRCDEAQVLQVWDDPYPEVLSQEPFHKVTVQSLLTVETLEHNQTYECRAHNSVGSGSWAFIP
ISAGAHTHPPDEFLFTPVVVACMSIMALLLLLLLLLL
YKYKQKPKYQVRWKIIESYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEAT
A
FGLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKAEAMLGPSLSPGQDPEGGVDYK
NIHLEKKYVRRDS
GFSSQGVDTYVEMRPVSTSSNDSFSEQDLDKEDGRPLELRDLLHFSSQVAQGMAFLASKNCIHRDVAARNVLLTNGHVAKIGDFGLA
RDI
MNDSNYIVKGNARLPVKWMAPESIFDCVYTVQSDVWSYGILLWEIFSLGLNPYPGILVNSKFYKLVKDGYQMAQPAFAPKNIYSIMQACWALEPTHR
PTFQQICSFLQEQAQEDRRERDYTNLPSSSRSGGSGSSSSELEEESSSEHLTCCEQGDIAQPLLQPNNYQFC



DME EC Prediction for this protein is: 2.7.10.1
Check another protein