Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DKIVGGY3.4.21.4;Trypsin. 22 -
GYHFCGGSLI3.4.21.4;Trypsin. 44
  • Domain: Peptidase S1
HFCGGSL3.4.21;Serine endopeptidases. 46
  • Domain: Peptidase S1
FCGGSLI3.4.21;Serine endopeptidases. 47
  • Domain: Peptidase S1
IQVRLGE3.4.21.4;Trypsin. 69
  • Domain: Peptidase S1
VRLGEHN3.4.21;Serine endopeptidases. 71
  • Metal Site E=Glutamic acid at location 75 on the protein
  • Metal Site Description: Calcium (By similarity).
  • Domain: Peptidase S1
VRLGEHNI3.4.21.4;Trypsin. 71
  • Metal Site E=Glutamic acid at location 75 on the protein
  • Metal Site Description: Calcium (By similarity).
  • Domain: Peptidase S1
NDIMLIKL3.4.21.4;Trypsin. 106
  • Active Site D=Aspartic acid at location 107 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
DIMLIKL3.4.21;Serine endopeptidases. 107
  • Active Site D=Aspartic acid at location 107 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
CLISGWG3.4.21.4;Trypsin. 139
  • Domain: Peptidase S1
GADYPDEL3.4.21.4;Trypsin. 151
  • Domain: Peptidase S1
LQCLDAP3.4.21.4;Trypsin. 158
  • Domain: Peptidase S1
CEASYPG3.4.21.4;Trypsin. 171
  • Domain: Peptidase S1
GFLEGGKDSC3.4.21.4;Trypsin. 187
  • Domain: Peptidase S1
EGGKDSC3.4.21;Serine endopeptidases. 190
  • Domain: Peptidase S1
DSCQGDSGG3.4.21;Serine endopeptidases. 194
  • Active Site S=Serine at location 200 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 200 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
CQGDSGGP3.4.21;Serine endopeptidases. 196
  • Active Site S=Serine at location 200 on the protein
  • Active Site Description: Charge relay system (By simila
  • Binding Site S=Serine at location 200 on the protein
  • Binding site description: Substrate.
  • Domain: Peptidase S1
DSGGPVVCNG3.4.21.4;Trypsin. 199
  • Active Site S=Serine at location 200 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
CNGQLQG3.4.21.4;Trypsin. 206
  • Domain: Peptidase S1
LQGVVSWG3.4.21.4;Trypsin. 210
  • Domain: Peptidase S1
GCAQKNKPGVYTKV3.4.21.4;Trypsin. 219
  • Domain: Peptidase S1
PGVYTKV3.4.21;Serine endopeptidases. 226
  • Domain: Peptidase S1
PGVYTKVYNYV3.4.21.4;Trypsin. 226
  • Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYD
RKTLN
NDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDS
GGPVVCNGQLQGVVSWG
DGCAQKNKPGVYTKVYNYVKWIKNTIAANS



DME EC Prediction for this protein is: 3.4.21.4
Check another protein