Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SRGFLFGP2.4.2.7;Adenine phosphoribosyltransferase. 66 -
GKLPGPT2.4.2.7;Adenine phosphoribosyltransferase. 90
  • Gene: APT
SYSLEYG2.4.2.7;Adenine phosphoribosyltransferase. 100
  • Gene: APT
LEYGKAELEIQKDALEPGQ2.4.2.7;Adenine phosphoribosyltransferase. 103
  • Gene: APT
DDLLATGG2.4.2.7;Adenine phosphoribosyltransferase. 127 -
ECVSLVELTSLKGRE2.4.2.7;Adenine phosphoribosyltransferase. 152
  • Gene: APT
LKGREKL2.4.2.7;Adenine phosphoribosyltransferase. 162
  • Gene: APT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWAS
YSLEYGKAELEIQKDALEPGQ
RVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE



DME EC Prediction for this protein is: 2.4.2.7
Check another protein