Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
TLGIGKA2.7.1;Phosphotransferases with an alcohol group as acceptor. 11 -
VLTSGGD2.7.1.11;6-phosphofructokinase. 20 -
GMNAAVR2.7.1.11;6-phosphofructokinase. 29 -
EGYQGLVDGG2.7.1.11;6-phosphofructokinase. 53 -
QLGGTVIGSARCK2.7.1.11;6-phosphofructokinase. 78 -
REREGRL2.7.1;Phosphotransferases with an alcohol group as acceptor. 93 -
GITNLCVIGG2.7.1.11;6-phosphofructokinase. 109 -
GGDGSLTGA2.7.1.11;6-phosphofructokinase. 117 -
DLQKAGKIT2.7.1.11;6-phosphofructokinase. 138
  • Gene: K6PF
VGSIDND2.7.1.11;6-phosphofructokinase. 162
  • Active Site D=Aspartic acid at location 166 on the protein
  • Active Site Description: Proton acceptor (By similarity
DAITTTAQSHQRTFVLEVMGR2.7.1.11;6-phosphofructokinase. 190
  • Binding Site R=Arginine at location 201 on the protein
  • Binding site description: Substrate (By similarity).
EVMGRHCG2.7.1.11;6-phosphofructokinase. 206 -
CGYLALV2.7.1.11;6-phosphofructokinase. 212 -
ADWVFIPE2.7.1.11;6-phosphofructokinase. 225
  • Gene: K6PF
IIIVAEG2.7.1.11;6-phosphofructokinase. 259 -
RVTVLGH2.7.1.11;6-phosphofructokinase. 292
  • Binding Site R=Arginine at location 292 on the protein
  • Binding site description: Substrate (By similarity).
GHVQRGG2.7.1;Phosphotransferases with an alcohol group as acceptor. 297
  • Binding Site H=Histidine at location 298 on the protein
  • Binding site description: Substrate (By similarity).
QRGGTPS2.7.1.11;6-phosphofructokinase. 300
  • Binding Site R=Arginine at location 301 on the protein
  • Binding site description: Substrate (By similarity).
EAVMALLE2.7.1.11;6-phosphofructokinase. 319 -
TPDTPACVV2.7.1.11;6-phosphofructokinase. 328 -
TPACVVSLSGN2.7.1.11;6-phosphofructokinase. 331 -
VRLPLMECVQ2.7.1.11;6-phosphofructokinase. 344 -
KLRGRSFMNNWEVYKLLAH2.7.1.11;6-phosphofructokinase. 372
  • Gene: K6PF
VGAPAAGMN2.7.1.11;6-phosphofructokinase. 408 -
GMNAAVR2.7.1.11;6-phosphofructokinase. 414 -
VGGWTGQGGS2.7.1.11;6-phosphofructokinase. 456 -
LGTKRTLP2.7.1.11;6-phosphofructokinase. 467 -
EQISANITK2.7.1.11;6-phosphofructokinase. 479
  • Gene: K6PF
KFNIQGL2.7.1.11;6-phosphofructokinase. 487 -
IIGGFEA2.7.1.11;6-phosphofructokinase. 495 -
GGFEAYTGGLELMEGRKQ2.7.1.11;6-phosphofructokinase. 497
  • Gene: K6PF
PATVSNNVPGSDFS2.7.1.11;6-phosphofructokinase. 526 -
GADTALNTI2.7.1.11;6-phosphofructokinase. 541 -
CDRIKQSA2.7.1.11;6-phosphofructokinase. 553 -
GTKRRVFI2.7.1.11;6-phosphofructokinase. 562 -
ETMGGYCGYLAT2.7.1.11;6-phosphofructokinase. 571 -
GADAAYI2.7.1.11;6-phosphofructokinase. 589 -
PFTIRDLQ2.7.1.11;6-phosphofructokinase. 599
  • Gene: K6PF
RGLVLRNEKC2.7.1.11;6-phosphofructokinase. 622 -
NYTTDFI2.7.1.11;6-phosphofructokinase. 634 -
RKNVLGHMQQGG2.7.1.11;6-phosphofructokinase. 655 -
PTPFDRN2.7.1.11;6-phosphofructokinase. 668 -
FQPVAELK2.7.1.11;6-phosphofructokinase. 720 -
QWWLKLRP2.7.1.11;6-phosphofructokinase. 740 -
HAHLEHI2.7.1.11;6-phosphofructokinase. 764
  • Gene: K6PF

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLR
AAYNLVKR
GITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQ
RTFVLEVMGRHCGYLALV
TSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPS
AFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGS
HTVAVMN
VGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISANITKFNIQGLVIIGGFE
AYTGGLELMEGRKQ
FDELCIPFVVIPATVSNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQ
ANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRI
FANTPDSGCVLGMRKRALV
FQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHITRKRSGEAAV



DME EC Prediction for this protein is: 2.7.1.11
Check another protein