Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
FLEELRPGSLERECKEE3.4.21.21;Coagulation factor VIIa. 64
  • Domain: Gla
  • Gene: FA7
FEEAREIF3.4.21;Serine endopeptidases. 84
  • Domain: Gla
NGGSCKD3.4.21;Serine endopeptidases. 117
  • Domain: EGF-like 1; calcium-
QSYICFCL3.4.21.21;Coagulation factor VIIa. 126
  • Domain: EGF-like 1; calcium-
  • Gene: FA7
FEGRNCE3.4.21;Serine endopeptidases. 136
  • Domain: EGF-like
ENGGCEQYCSDH3.4.21.21;Coagulation factor VIIa. 154
  • Domain: EGF-like
  • Gene: FA7
RSCRCHEGY3.4.21.21;Coagulation factor VIIa. 170
  • Domain: EGF-like
  • Gene: FA7
PTVEYPCGKIP3.4.21.21;Coagulation factor VIIa. 189
  • Gene: FA7
VCPKGECPWQ3.4.21.21;Coagulation factor VIIa. 218
  • Domain: Peptidase S1
  • Gene: FA7
CGGTLIN3.4.21;Serine endopeptidases. 238
  • Domain: Peptidase S1
WVVSAAHC3.4.21;Serine endopeptidases. 247
  • Active Site H=Histidine at location 253 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
VVPLCLPE3.4.21.21;Coagulation factor VIIa. 318
  • Domain: Peptidase S1
  • Gene: FA7
TLAFVRFS3.4.21.21;Coagulation factor VIIa. 332
  • Domain: Peptidase S1
  • Gene: FA7
VSGWGQLLDRGATALELM3.4.21.21;Coagulation factor VIIa. 341
  • Domain: Peptidase S1
  • Gene: FA7
VPRLMTQDC3.4.21.21;Coagulation factor VIIa. 362
  • Domain: Peptidase S1
  • Gene: FA7
TQDCLQQSR3.4.21.21;Coagulation factor VIIa. 367
  • Domain: Peptidase S1
  • Gene: FA7
MFCAGYSDGSKD3.4.21.21;Coagulation factor VIIa. 387
  • Domain: Peptidase S1
  • Gene: FA7
CKGDSGG3.4.21;Serine endopeptidases. 400
  • Active Site S=Serine at location 404 on the protein
  • Active Site Description: Charge relay system (By simila
  • Domain: Peptidase S1
TGIVSWG3.4.21;Serine endopeptidases. 419
  • Domain: Peptidase S1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MVSQALRLLCLLLGLQGCLAAGGVAKASGGETRDMPWKPGPHRVFVTQEEAHGVLHRRRRANAFLEELRPGSLERECKEEQCSFEEAREIFKDAERTKLF
WISYSDGDQCASSPCQNGGSCKDQLQSYICFCLPAFEGRNCETHKDDQLICVNENGGCEQYCSDHTGTKRSCRCHEGYSLLADGVSCTPTVEYPCGKIPI
LEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN
HDIALLRLHQPVVLTDHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDSPNITEYMFCAGYSDGSKDSC
KGDSGGPHATHYRGTWYLTGIVSWGQGCATVGHFGVYTRVSQYIEWLQKLMRSEPRPGVLLRAPFP


DME EC Prediction for this protein is: 3.4.21.21
Check another protein