Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data

Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
PRCGVPD3.4.24;Metalloendopeptidases. 89
  • Metal Site C=Cysteine at location 91 on the protein
  • Metal Site Description: Zinc; in inhibited form (By si
YRIVNYT3.4.24;Metalloendopeptidases. 115 -
GEADIMI3.4.24;Metalloendopeptidases. 154
  • Metal Site D=Aspartic acid at location 157 on the protein
  • Metal Site Description: Calcium 2 (By similarity).
HAYPPGPG3.4.24;Metalloendopeptidases. 182
  • Metal Site H=Histidine at location 182 on the protein
  • Metal Site Description: Zinc 1 (By similarity).
GTNLFLVA3.4.24;Metalloendopeptidases. 208 -
LFLVAAHE3.4.24;Metalloendopeptidases. 211
  • Metal Site H=Histidine at location 217 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
HSLGLFH3.4.24;Metalloendopeptidases. 221
  • Metal Site H=Histidine at location 221 on the protein
  • Metal Site Description: Zinc 2; catalytic (By similari
GIQSLYG3.4.24;Metalloendopeptidases. 257 -
LSFDAISTLRGE3.4.24;Metalloendopeptidases. 293
  • Metal Site D=Aspartic acid at location 296 on the protein
  • Metal Site Description: Calcium 4; via carbonyl oxygen
EPEFHLIS3.4.24;Metalloendopeptidases. 322
  • Domain: Hemopexin-like
IHTLGFP3.4.24;Metalloendopeptidases. 375
  • Domain: Hemopexin-like
DKYWRFDE3.4.24;Metalloendopeptidases. 405
  • Domain: Hemopexin-like

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MMHLAFLVLLCLPVCSAYPLSGAAKEEDSNKDLAQQYLEKYYNLEKDVKQFRRKDSNLIVKKIQGMQKFLGLEVTGKLDTDTLEVMRKPRCGVPDVGHFS
SFPGMPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEGEADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDE
KWTEDASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDDVNGIQSLYGPPPASTEEPLVPTKSVPSGSEMPAKCDPALSFDAIST
LRGEYLFFKDRYFWRRSHWNPEPEFHLISAFWPSLPSYLDAAYEVNSRDTVFIFKGNEFWAIRGNEVQAGYPRGIHTLGFPPTIRKIDAAVSDKEKKKTY
FFAADKYWRFDENSQSMEQGFPRLIADDFPGVEPKVDAVLQAFGFFYFFSGSSQFEFDPNARMVTHILKSNSWLHC


DME EC Prediction for this protein is: 3.4.24
Check another protein