Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
NVPVRVLELSESHP2.7.10.1;Receptor protein-tyrosine kinase. 414
  • Gene: PGFRB
KPRYEIRW2.7.10.1;Receptor protein-tyrosine kinase. 559 -
DGHEYIYVDP2.7.10.1;Receptor protein-tyrosine kinase. 575 -
LVLGRTLGSGAFG2.7.10.1;Receptor protein-tyrosine kinase. 600
  • Domain: Protein kinase
  • Gene: PGFRB
VVEATAHGLSHSQ2.7.10.1;Receptor protein-tyrosine kinase. 614
  • Domain: Protein kinase
  • Gene: PGFRB
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 631
  • Binding Site K=Lysine at location 634 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ALMSELK2.7.10.1;Receptor protein-tyrosine kinase. 647
  • Domain: Protein kinase
HLNVVNLLGACTK2.7.10.1;Receptor protein-tyrosine kinase. 661
  • Domain: Protein kinase
GPIYIITEYC2.7.10.1;Receptor protein-tyrosine kinase. 675
  • Domain: Protein kinase
PIYIITE2.7.10;Protein-tyrosine kinases. 676
  • Domain: Protein kinase
TEYCRYGDLVDYLHRNKHTFLQ2.7.10.1;Receptor protein-tyrosine kinase. 681
  • Domain: Protein kinase
  • Gene: PGFRB
ESDGGYMDMSKDE2.7.10.1;Receptor protein-tyrosine kinase. 735
  • Domain: Protein kinase
  • Gene: PGFRB
FLASKNCVHRDLAARNVL2.7.10.1;Receptor protein-tyrosine kinase. 816
  • Active Site D=Aspartic acid at location 826 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
RDLAARN2.7.10;Protein-tyrosine kinases. 825
  • Active Site D=Aspartic acid at location 826 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KICDFGLARD2.7.10.1;Receptor protein-tyrosine kinase. 841
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 844
  • Domain: Protein kinase
KWMAPESIF2.7.10.1;Receptor protein-tyrosine kinase. 868
  • Domain: Protein kinase
LYTTLSDVWS2.7.10.1;Receptor protein-tyrosine kinase. 879
  • Domain: Protein kinase
GILLWEIF2.7.10.1;Receptor protein-tyrosine kinase. 890
  • Domain: Protein kinase
LGGTPYP2.7.10.1;Receptor protein-tyrosine kinase. 899
  • Domain: Protein kinase
PAHASDE2.7.10.1;Receptor protein-tyrosine kinase. 926
  • Domain: Protein kinase
  • Gene: PGFRB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFC
THNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVD
SDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFH
EDAEVQLSFQLQI
NVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQHV
DRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQK
KPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFG
QVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTF
LQ
HHSDKRRPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPSAPERTCRATLINESPVLSY
MDLVGFSYQVANGME
FLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYP
ELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRS
PLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAE
AEDSFL



DME EC Prediction for this protein is: 2.7.10.1
Check another protein