Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
DPGFVKWTFE2.7.10.1;Receptor protein-tyrosine kinase. 60
  • Domain: Ig-like C2-type
  • Gene: KIT
SIYVFVRDP2.7.10.1;Receptor protein-tyrosine kinase. 106
  • Domain: Ig-like C2-type
  • Gene: KIT
LVRCPLTDPEVTNYSL2.7.10.1;Receptor protein-tyrosine kinase. 133
  • Domain: Ig-like C2-type
  • Gene: KIT
YHRLCLHCS2.7.10.1;Receptor protein-tyrosine kinase. 179
  • Domain: Ig-like C2-type
  • Gene: KIT
IKDVSSSV2.7.10.1;Receptor protein-tyrosine kinase. 235
  • Domain: Ig-like C2-type
  • Gene: KIT
QWIYMNRT2.7.10.1;Receptor protein-tyrosine kinase. 347
  • Domain: Ig-like C2-type
  • Gene: KIT
TDKWEDYPKS2.7.10.1;Receptor protein-tyrosine kinase. 356
  • Domain: Ig-like C2-type
  • Gene: KIT
DYPKSENESNIRYV2.7.10.1;Receptor protein-tyrosine kinase. 361
  • Domain: Ig-like C2-type
  • Gene: KIT
EGGTYTF2.7.10.1;Receptor protein-tyrosine kinase. 386
  • Domain: Ig-like C2-type
  • Gene: KIT
NGMLQCV2.7.10.1;Receptor protein-tyrosine kinase. 423
  • Domain: Ig-like C2-type
  • Gene: KIT
AGFPEPT2.7.10.1;Receptor protein-tyrosine kinase. 431
  • Domain: Ig-like C2-type
  • Gene: KIT
GFPEPTIDWYFC2.7.10.1;Receptor protein-tyrosine kinase. 432
  • Domain: Ig-like C2-type
  • Gene: KIT
WYFCPGTEQRC2.7.10.1;Receptor protein-tyrosine kinase. 440
  • Domain: Ig-like C2-type
  • Gene: KIT
HNGTVEC2.7.10.1;Receptor protein-tyrosine kinase. 485
  • Domain: Ig-like C2-type
  • Gene: KIT
MCIIVMIL2.7.10.1;Receptor protein-tyrosine kinase. 536
  • Gene: KIT
YKYLQKP2.7.10.1;Receptor protein-tyrosine kinase. 545
  • Gene: KIT
IDPTQLPY2.7.10.1;Receptor protein-tyrosine kinase. 571 -
GAFGKVVEATA2.7.10.1;Receptor protein-tyrosine kinase. 598
  • Domain: Protein kinase
VAVKMLK2.7.10.1;Receptor protein-tyrosine kinase. 620
  • Binding Site K=Lysine at location 623 on the protein
  • Binding site description: ATP (By similarity).
  • Domain: Protein kinase
ALMSELK2.7.10.1;Receptor protein-tyrosine kinase. 636
  • Domain: Protein kinase
NIVNLLGACT2.7.10.1;Receptor protein-tyrosine kinase. 652
  • Domain: Protein kinase
GGPTLVITEYCC2.7.10.1;Receptor protein-tyrosine kinase. 663
  • Domain: Protein kinase
EYCCYGDLLN2.7.10.1;Receptor protein-tyrosine kinase. 671
  • Domain: Protein kinase
ALYKNLL2.7.10.1;Receptor protein-tyrosine kinase. 701
  • Domain: Protein kinase
  • Gene: KIT
NEYMDMKPGVSY2.7.10.1;Receptor protein-tyrosine kinase. 719
  • Domain: Protein kinase
  • Gene: KIT
VSYVVPTK2.7.10.1;Receptor protein-tyrosine kinase. 728
  • Domain: Protein kinase
  • Gene: KIT
EDDELALD2.7.10.1;Receptor protein-tyrosine kinase. 758
  • Domain: Protein kinase
  • Gene: KIT
RDLAARN2.7.10;Protein-tyrosine kinases. 791
  • Active Site D=Aspartic acid at location 792 on the protein
  • Active Site Description: Proton acceptor (By similarity
  • Domain: Protein kinase
KICDFGLARD2.7.10.1;Receptor protein-tyrosine kinase. 807
  • Domain: Protein kinase
DFGLARDI2.7.10.1;Receptor protein-tyrosine kinase. 810
  • Domain: Protein kinase
KGNARLP2.7.10.1;Receptor protein-tyrosine kinase. 826
  • Domain: Protein kinase
LPVKWMA2.7.10.1;Receptor protein-tyrosine kinase. 831
  • Domain: Protein kinase
PVKWMAPE2.7.10.1;Receptor protein-tyrosine kinase. 832
  • Domain: Protein kinase
KWMAPESIF2.7.10.1;Receptor protein-tyrosine kinase. 834
  • Domain: Protein kinase
CVYTFESDVWSYGI2.7.10.1;Receptor protein-tyrosine kinase. 844
  • Domain: Protein kinase
SDVWSYGI2.7.10;Protein-tyrosine kinases. 850
  • Domain: Protein kinase
FSLGSSPYPGMPVDSKFYKMIKEG2.7.10.1;Receptor protein-tyrosine kinase. 863
  • Domain: Protein kinase
SPEHAPAEMYD2.7.10.1;Receptor protein-tyrosine kinase. 891
  • Domain: Protein kinase
  • Gene: KIT
MKTCWDADPLKRPTFKQ2.7.10.1;Receptor protein-tyrosine kinase. 903
  • Domain: Protein kinase
  • Gene: KIT
HIYSNLANC2.7.10.1;Receptor protein-tyrosine kinase. 934
  • Domain: Protein kinase
  • Gene: KIT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNK
HGLSN
SIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKF
ILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCT
IKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQ
QWIYMNRTFTDKWEDYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVN
AAIAFNVYVNTKPEILTYDRLV
NGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKT
SAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGM
MCIIVMILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATA
YGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEA
ALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILL
THGRIT
KICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
D
IMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV



DME EC Prediction for this protein is: 2.7.10.1
Check another protein