Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
VHLIGYSLGAHV3.1.1.3;Triacylglycerol lipase. 162
  • Active Site S=Serine at location 168 on the protein
  • Active Site Description: Nucleophile (By similarity).
GRITGLD3.1.1.3;Triacylglycerol lipase. 188 -
RLSPDDA3.1.1;Carboxylic ester hydrolases. 208 -
EHMGLSVG3.1.1.3;Triacylglycerol lipase. 226
  • Gene: LIPC
DFYPNGG3.1.1.3;Triacylglycerol lipase. 242 -
KCSHERS3.1.1;Carboxylic ester hydrolases. 276
  • Active Site H=Histidine at location 279 on the protein
  • Active Site Description: Charge relay system (By simila
HLFIDSL3.1.1;Carboxylic ester hydrolases. 284 -
PFKVYHYQ3.1.1.3;Triacylglycerol lipase. 348 -
KIQFINQ3.1.1.3;Triacylglycerol lipase. 357
  • Domain: PLAT
  • Gene: LIPC
NKTYSFL3.1.1;Carboxylic ester hydrolases. 397
  • Domain: PLAT
VKAGETQ3.1.1;Carboxylic ester hydrolases. 455
  • Domain: PLAT

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWI
WQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSH
VHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLF
EGSAPSN
RLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQS
PFKVYHYQFKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTY
SFL
ITLDVDIGELIMIKFKWENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR



DME EC Prediction for this protein is: 3.1.1.3
Check another protein