Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GEEVAQYDGAYK1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 57
  • Gene: ODPB
GLWKKYGD1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 72
  • Gene: ODPB
RIIDTPI1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 81
  • Gene: ODPB
EMGFAGIAVGAA1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 89
  • Binding Site E=Glutamic acid at location 89 on the protein
  • Binding site description: Thiamine pyrophosphate (By sim
  • Gene: ODPB
GLRPICEFM1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 103
  • Gene: ODPB
NFSMQAID1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 114
  • Gene: ODPB
PIVFRGPNGA1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 141 -
AQHSQCFAAWYG1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 156
  • Gene: ODPB
PGLKVVSP1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 170
  • Gene: ODPB
AKGLIKS1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 183
  • Gene: ODPB
AIRDNNPV1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 190
  • Gene: ODPB
LENELMYGV1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 200
  • Gene: ODPB
EAQSKDFLIPIGKAKIERQGTH1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 215
  • Gene: ODPB
RVTGADVP1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 324
  • Gene: ODPB
PQVKDIIFA1.2.4.1;Pyruvate dehydrogenase (acetyl-transferring). 344
  • Gene: ODPB

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAA
MAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVL
ENELMYGV
PFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAV
RVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI



DME EC Prediction for this protein is: 1.2.4.1
Check another protein