Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
GASGDLAK1.1.1.49;Glucose-6-phosphate dehydrogenase. 38
  • Binding Site S=Serine at location 40 on the protein
  • Binding site description: NADP (By similarity).
IYPTIWWLF1.1.1.49;Glucose-6-phosphate dehydrogenase. 48 -
FKATPEE1.1.1.49;Glucose-6-phosphate dehydrogenase. 88 -
RNSYVAGQYD1.1.1.49;Glucose-6-phosphate dehydrogenase. 104 -
LNSHMNALH1.1.1.49;Glucose-6-phosphate dehydrogenase. 121 -
LFYLALPP1.1.1.49;Glucose-6-phosphate dehydrogenase. 137 -
IVEKPFG1.1.1.49;Glucose-6-phosphate dehydrogenase. 168 -
EKPFGRD1.1.1.49;Glucose-6-phosphate dehydrogenase. 170 -
LSNHISSLF1.1.1.49;Glucose-6-phosphate dehydrogenase. 183 -
QIYRIDH1.1.1.49;Glucose-6-phosphate dehydrogenase. 195 -
RIDHYLGKE1.1.1.49;Glucose-6-phosphate dehydrogenase. 198
  • Binding Site H=Histidine at location 201 on the protein
  • Binding site description: Substrate (By similarity).
VQNLMVLRF1.1.1.49;Glucose-6-phosphate dehydrogenase. 208 -
NRIFGPIWNRDNIACVI1.1.1.49;Glucose-6-phosphate dehydrogenase. 218 -
TFKEPFGT1.1.1.49;Glucose-6-phosphate dehydrogenase. 236
  • Binding Site K=Lysine at location 238 on the protein
  • Binding site description: NADP (By similarity).
GRGGYFD1.1.1.49;Glucose-6-phosphate dehydrogenase. 245 -
DVMQNHLLQ1.1.1.49;Glucose-6-phosphate dehydrogenase. 258
  • Active Site H=Histidine at location 263 on the protein
  • Active Site Description: Proton acceptor (By similarity
LVAMEKP1.1.1.49;Glucose-6-phosphate dehydrogenase. 270 -
RDEKVKVL1.1.1.49;Glucose-6-phosphate dehydrogenase. 285 -
GYLDDPTV1.1.1.49;Glucose-6-phosphate dehydrogenase. 321 -
GVPFILRCGK1.1.1.49;Glucose-6-phosphate dehydrogenase. 351
  • Binding Site R=Arginine at location 357 on the protein
  • Binding site description: NADP (By similarity).
LNERKAEVR1.1.1.49;Glucose-6-phosphate dehydrogenase. 362 -
NELVIRVQP1.1.1.49;Glucose-6-phosphate dehydrogenase. 388 -
MMTKKPGMFFNPEESELDLTYGN1.1.1.49;Glucose-6-phosphate dehydrogenase. 404 -
PDAYERL1.1.1.49;Glucose-6-phosphate dehydrogenase. 434 -
AYERLILDVFCG1.1.1.49;Glucose-6-phosphate dehydrogenase. 436 -
EAWRIFTP1.1.1.49;Glucose-6-phosphate dehydrogenase. 460 -
IFTPLLH1.1.1.49;Glucose-6-phosphate dehydrogenase. 464 -
YEGTYKWVNPH1.1.1.49;Glucose-6-phosphate dehydrogenase. 503 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MAEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPEEKLKLED
FFA
RNSYVAGQYDDAASYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRID
HYLGKE
MVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQA
NNVVLGQYVGNPDGEGEATK
GYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAV
YTK
MMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVG
FQ
YEGTYKWVNPHKL



DME EC Prediction for this protein is: 1.1.1.49
Check another protein