Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SLLFYAQ2.3.1.37;5-aminolevulinate synthase. 25
  • Gene: HEM1
KQRPERVSHLLQD2.3.1.37;5-aminolevulinate synthase. 176
  • Gene: HEM1
LPKSVSTFQYD2.3.1.37;5-aminolevulinate synthase. 190
  • Gene: HEM1
FFEKKIDEKK2.3.1.37;5-aminolevulinate synthase. 202
  • Gene: HEM1
YRVFKTVNR2.3.1.37;5-aminolevulinate synthase. 216 -
VWCSNDYL2.3.1.37;5-aminolevulinate synthase. 247 -
GAGGTRNI2.3.1.37;5-aminolevulinate synthase. 276 -
KDAALLF2.3.1.37;5-aminolevulinate synthase. 303
  • Gene: HEM1
FSSCFVAND2.3.1.37;5-aminolevulinate synthase. 309 -
VANDSTL2.3.1.37;5-aminolevulinate synthase. 314 -
PGCEIYSD2.3.1.37;5-aminolevulinate synthase. 328 -
IFRHNDV2.3.1.37;5-aminolevulinate synthase. 355
  • Gene: HEM1
HLRELLQRSDP2.3.1.37;5-aminolevulinate synthase. 363
  • Gene: HEM1
PKIVAFE2.3.1.37;5-aminolevulinate synthase. 376 -
VHSMDGA2.3.1.37;5-aminolevulinate synthase. 384 -
DEVHAVGLYG2.3.1.37;5-aminolevulinate synthase. 411 -
DIISGTLGKA2.3.1.37;5-aminolevulinate synthase. 437 -
GCVGGYIA2.3.1.37;5-aminolevulinate synthase. 448 -
GFIFTTSLPP2.3.1.37;5-aminolevulinate synthase. 470 -
GALESVR2.3.1.37;5-aminolevulinate synthase. 484 -
CPSHIIP2.3.1.37;5-aminolevulinate synthase. 525 -
RVADAAKNTE2.3.1.37;5-aminolevulinate synthase. 533
  • Gene: HEM1
IYVQAIN2.3.1.37;5-aminolevulinate synthase. 553 -
LLRIAPTPHH2.3.1.37;5-aminolevulinate synthase. 569 -
PTPHHTP2.3.1;Transferring groups other than amino-acyl groups. 574 -
VGLELKPHSSAEC2.3.1.37;5-aminolevulinate synthase. 597
  • Gene: HEM1
CNFCRRP2.3.1.37;5-aminolevulinate synthase. 609 -
PLHFEVM2.3.1.37;5-aminolevulinate synthase. 615
  • Gene: HEM1

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MESVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRALSTAAVHYQQIKETPPASEKDKTAKAKVQQTPDGSQQSPDGTQLPSGHPLPAT
SQGTASKCPFLAAQMNQRGSSVFCKASLELQEDVQEMNAVRKEVAETSAGPSVVSVKTDGGDPSGLLKNFQDIMQ
KQRPERVSHLLQDNLPKSVSTFQYD
RFFEKKIDEKKNDHTYRVFKTVNRRAHIFPMADDYSDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMDTLKQHGAGAGGTRNISGTSKFHVDLERELADL
HG
KDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRHNDVSHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDV
AHEFGAITFV
DEVHAVGLYGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSSLIDTVRSYAAGFIFTTSLPPMLLAGALESVRILKSAEGRVL
RRQHQRNVKLMRQMLMDAGLPVVH
CPSHIIPVRVADAAKNTEVCDELMSRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNYFLENLLVTWKQVGLE
LKPHSSAECNFCRRPLHFEVM
SEREKSYFSGLSKLVSAQA



DME EC Prediction for this protein is: 2.3.1.37
Check another protein