Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
SPLEKAS3.6.3.49;Channel-conductance-controlling ATPase. 4
  • Gene: CFTR
SKLFFSW3.6.3.49;Channel-conductance-controlling ATPase. 13
  • Gene: CFTR
PILRKGYR3.6.3.49;Channel-conductance-controlling ATPase. 22
  • Gene: CFTR
KGYRQRLE3.6.3.49;Channel-conductance-controlling ATPase. 26
  • Gene: CFTR
LEREWDRE3.6.3.49;Channel-conductance-controlling ATPase. 53
  • Gene: CFTR
SKKNPKL3.6.3.49;Channel-conductance-controlling ATPase. 63
  • Gene: CFTR
RCFFWRF3.6.3.49;Channel-conductance-controlling ATPase. 75
  • Gene: CFTR
LYLGEVTK3.6.3.49;Channel-conductance-controlling ATPase. 88
  • Domain: ABC transmembrane ty
  • Gene: CFTR
TKAVQPL3.6.3.49;Channel-conductance-controlling ATPase. 94
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LGRIIASY3.6.3.49;Channel-conductance-controlling ATPase. 102
  • Domain: ABC transmembrane ty
  • Gene: CFTR
ERSIAIYL3.6.3.49;Channel-conductance-controlling ATPase. 116
  • Domain: ABC transmembrane ty
  • Gene: CFTR
GMQMRIA3.6.3.49;Channel-conductance-controlling ATPase. 149
  • Domain: ABC transmembrane ty
  • Gene: CFTR
FSLIYKK3.6.3.49;Channel-conductance-controlling ATPase. 157
  • Domain: ABC transmembrane ty
  • Gene: CFTR
SSRVLDKI3.6.3.49;Channel-conductance-controlling ATPase. 168
  • Domain: ABC transmembrane ty
  • Gene: CFTR
VLDKISI3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 171
  • Domain: ABC transmembrane ty
SLLSNNLNKFDEGLALAHF3.6.3.49;Channel-conductance-controlling ATPase. 182
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LSNNLNKFDEGLALAHFVWI3.6.3.49;Channel-conductance-controlling ATPase. 184
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LLMGLIW3.6.3.49;Channel-conductance-controlling ATPase. 210
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LLQASAF3.6.3.49;Channel-conductance-controlling ATPase. 218
  • Domain: ABC transmembrane ty
FCGLGFLI3.6.3.49;Channel-conductance-controlling ATPase. 224
  • Domain: ABC transmembrane ty
  • Gene: CFTR
FLIVLAL3.6.3.49;Channel-conductance-controlling ATPase. 229
  • Domain: ABC transmembrane ty
  • Gene: CFTR
KYRDQRA3.6.3.49;Channel-conductance-controlling ATPase. 246
  • Domain: ABC transmembrane ty
  • Gene: CFTR
SVKAYCWE3.6.3.49;Channel-conductance-controlling ATPase. 271
  • Domain: ABC transmembrane ty
  • Gene: CFTR
ELKLTRK3.6.3.49;Channel-conductance-controlling ATPase. 292
  • Domain: ABC transmembrane ty
  • Gene: CFTR
KAAYVRY3.6.3.49;Channel-conductance-controlling ATPase. 298
  • Domain: ABC transmembrane ty
  • Gene: CFTR
FVVFLSVLPYAL3.6.3.49;Channel-conductance-controlling ATPase. 316
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LRKIFTTISF3.6.3.49;Channel-conductance-controlling ATPase. 333
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LEYNLTTT3.6.3.49;Channel-conductance-controlling ATPase. 383
  • Gene: CFTR
VVMENVTA3.6.3.49;Channel-conductance-controlling ATPase. 392
  • Gene: CFTR
VTAFWEE3.6.3.49;Channel-conductance-controlling ATPase. 397
  • Gene: CFTR
FFSNFSL3.6.3.49;Channel-conductance-controlling ATPase. 429
  • Domain: ABC transporter
  • Gene: CFTR
LLGTPVLKDI3.6.3.49;Channel-conductance-controlling ATPase. 435
  • Domain: ABC transporter
  • Gene: CFTR
VLKDINF3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 440
  • Domain: ABC transporter
LKDINFK3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 441
  • Domain: ABC transporter
FKIERGQL3.6.3.49;Channel-conductance-controlling ATPase. 446
  • Domain: ABC transporter
  • Gene: CFTR
IERGQLLA3.6.3.49;Channel-conductance-controlling ATPase. 448
  • Domain: ABC transporter
  • Gene: CFTR
GKIKHSGRIS3.6.3.49;Channel-conductance-controlling ATPase. 480
  • Domain: ABC transporter
  • Gene: CFTR
WIMPGTIK3.6.3.49;Channel-conductance-controlling ATPase. 496
  • Domain: ABC transporter
  • Gene: CFTR
ACQLEEDI3.6.3.49;Channel-conductance-controlling ATPase. 523
  • Domain: ABC transporter
  • Gene: CFTR
KDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSP3.6.3.49;Channel-conductance-controlling ATPase. 536
  • Domain: ABC transporter
  • Gene: CFTR
YKDADLYLLDSPF3.6.3.49;Channel-conductance-controlling ATPase. 563
  • Domain: ABC transporter
  • Gene: CFTR
KEIFESC3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 584
  • Domain: ABC transporter
LILHEGS3.6.3.49;Channel-conductance-controlling ATPase. 617
  • Domain: ABC transporter
  • Gene: CFTR
YFYGTFSEL3.6.3.49;Channel-conductance-controlling ATPase. 625
  • Domain: ABC transporter
  • Gene: CFTR
PDFSSKLMG3.6.3.49;Channel-conductance-controlling ATPase. 638
  • Domain: ABC transporter
  • Gene: CFTR
AERRNSI3.6.3.49;Channel-conductance-controlling ATPase. 655
  • Gene: CFTR
ETKKQSFKQTGE3.6.3.49;Channel-conductance-controlling ATPase. 681
  • Gene: CFTR
NSIRKFS3.6.3.49;Channel-conductance-controlling ATPase. 706
  • Gene: CFTR
GIEEDSD3.6.3.49;Channel-conductance-controlling ATPase. 723
  • Gene: CFTR
PDSEQGE3.6.3.49;Channel-conductance-controlling ATPase. 740
  • Gene: CFTR
GEAILPR3.6.3.49;Channel-conductance-controlling ATPase. 745
  • Gene: CFTR
ILPRISVI3.6.3.49;Channel-conductance-controlling ATPase. 748
  • Gene: CFTR
RRQSVLNLMT3.6.3.49;Channel-conductance-controlling ATPase. 765
  • Gene: CFTR
NQGQNIHR3.6.3.49;Channel-conductance-controlling ATPase. 778
  • Gene: CFTR
SLAPQANL3.6.3.49;Channel-conductance-controlling ATPase. 795
  • Gene: CFTR
DIYSRRLSQ3.6.3.49;Channel-conductance-controlling ATPase. 806
  • Gene: CFTR
GLEISEEINEEDLKECF3.6.3.49;Channel-conductance-controlling ATPase. 817
  • Gene: CFTR
TTWNTYLR3.6.3.49;Channel-conductance-controlling ATPase. 844
  • Gene: CFTR
HKSLIFVLIWCL3.6.3.49;Channel-conductance-controlling ATPase. 856
  • Gene: CFTR
FVLIWCLV3.6.3.49;Channel-conductance-controlling ATPase. 861
  • Domain: ABC transmembrane ty
  • Gene: CFTR
SLVVLWLL3.6.3.49;Channel-conductance-controlling ATPase. 877
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LWLLGNT3.6.3.49;Channel-conductance-controlling ATPase. 881
  • Domain: ABC transmembrane ty
  • Gene: CFTR
QDKGNST3.6.3.49;Channel-conductance-controlling ATPase. 890
  • Domain: ABC transmembrane ty
  • Gene: CFTR
SYAVIIT3.6.3.49;Channel-conductance-controlling ATPase. 902
  • Domain: ABC transmembrane ty
  • Gene: CFTR
VIITSTS3.6.3.49;Channel-conductance-controlling ATPase. 905
  • Domain: ABC transmembrane ty
  • Gene: CFTR
YYVFYIYVGVAD3.6.3.49;Channel-conductance-controlling ATPase. 913
  • Domain: ABC transmembrane ty
  • Gene: CFTR
FYIYVGVADTLLA3.6.3.49;Channel-conductance-controlling ATPase. 916
  • Domain: ABC transmembrane ty
  • Gene: CFTR
FRGLPLVHTLITVSK3.6.3.49;Channel-conductance-controlling ATPase. 932
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LQAPMST3.6.3.49;Channel-conductance-controlling ATPase. 957
  • Domain: ABC transmembrane ty
  • Gene: CFTR
GGILNRFSKDIA3.6.3.49;Channel-conductance-controlling ATPase. 970
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LDDLLPLTIFDF3.6.3.49;Channel-conductance-controlling ATPase. 983
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LPLTIFDFIQL3.6.3.49;Channel-conductance-controlling ATPase. 987
  • Domain: ABC transmembrane ty
  • Gene: CFTR
QLLLIVIGA3.6.3.49;Channel-conductance-controlling ATPase. 996
  • Domain: ABC transmembrane ty
  • Gene: CFTR
LIVIGAIAVV3.6.3.49;Channel-conductance-controlling ATPase. 999
  • Domain: ABC transmembrane ty
  • Gene: CFTR
TSQQLKQLES3.6.3.49;Channel-conductance-controlling ATPase. 1036
  • Domain: ABC transmembrane ty
  • Gene: CFTR
RSPIFTHL3.6.3.49;Channel-conductance-controlling ATPase. 1048
  • Domain: ABC transmembrane ty
  • Gene: CFTR
WFLYLSTLRWFQMRIEMIFVIFFIAVTFISILT3.6.3.49;Channel-conductance-controlling ATPase. 1089
  • Domain: ABC transmembrane ty
  • Gene: CFTR
VTFISILTTG3.6.3.49;Channel-conductance-controlling ATPase. 1114
  • Domain: ABC transmembrane ty
  • Gene: CFTR
FISILTTGEGEG3.6.3.49;Channel-conductance-controlling ATPase. 1116
  • Domain: ABC transmembrane ty
  • Gene: CFTR
VGIILTLAMNIM3.6.3.49;Channel-conductance-controlling ATPase. 1129
  • Domain: ABC transmembrane ty
  • Gene: CFTR
TLQWAVN3.6.3.49;Channel-conductance-controlling ATPase. 1142
  • Domain: ABC transmembrane ty
  • Gene: CFTR
SIDVDSLMRSVSR3.6.3.49;Channel-conductance-controlling ATPase. 1150
  • Domain: ABC transmembrane ty
  • Gene: CFTR
DVDSLMR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1152
  • Domain: ABC transmembrane ty
LMRSVSRVFK3.6.3.49;Channel-conductance-controlling ATPase. 1156
  • Gene: CFTR
STKPYKNGQL3.6.3.49;Channel-conductance-controlling ATPase. 1178
  • Gene: CFTR
QLSKVMI3.6.3.49;Channel-conductance-controlling ATPase. 1186
  • Gene: CFTR
KVMIIEN3.6.3.49;Channel-conductance-controlling ATPase. 1189
  • Gene: CFTR
DIWPSGG3.6.3.49;Channel-conductance-controlling ATPase. 1202
  • Gene: CFTR
KDLTAKY3.6.3.49;Channel-conductance-controlling ATPase. 1213
  • Domain: ABC transporter
  • Gene: CFTR
AKYTEGGN3.6.3.49;Channel-conductance-controlling ATPase. 1217
  • Domain: ABC transporter
  • Gene: CFTR
LENISFS3.6.3.49;Channel-conductance-controlling ATPase. 1227
  • Domain: ABC transporter
  • Gene: CFTR
NISFSIS3.6.3.49;Channel-conductance-controlling ATPase. 1229
  • Domain: ABC transporter
  • Gene: CFTR
GQRVGLLGRTG3.6.3.49;Channel-conductance-controlling ATPase. 1237
  • Domain: ABC transporter
  • Gene: CFTR
TGSGKSTL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1246
  • Domain: ABC transporter
GKSTLLSA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1249
  • Domain: ABC transporter
AFLRLLNT3.6.3.49;Channel-conductance-controlling ATPase. 1256
  • Domain: ABC transporter
  • Gene: CFTR
GEIQIDGVSWDS3.6.3.49;Channel-conductance-controlling ATPase. 1265
  • Domain: ABC transporter
  • Gene: CFTR
WRKAFGVI3.6.3.49;Channel-conductance-controlling ATPase. 1282
  • Domain: ABC transporter
  • Gene: CFTR
RKNLDPY3.6.3.49;Channel-conductance-controlling ATPase. 1301
  • Domain: ABC transporter
  • Gene: CFTR
DQEIWKVA3.6.3.49;Channel-conductance-controlling ATPase. 1312
  • Domain: ABC transporter
  • Gene: CFTR
WKVADEVGL3.6.3.49;Channel-conductance-controlling ATPase. 1316
  • Domain: ABC transporter
  • Gene: CFTR
SVIEQFPG3.6.3.49;Channel-conductance-controlling ATPase. 1326
  • Domain: ABC transporter
  • Gene: CFTR
FVLVDGG3.6.3.49;Channel-conductance-controlling ATPase. 1337
  • Domain: ABC transporter
  • Gene: CFTR
VLSHGHKQL3.6.3.49;Channel-conductance-controlling ATPase. 1345
  • Domain: ABC transporter
  • Gene: CFTR
GHKQLMCLARS3.6.3.49;Channel-conductance-controlling ATPase. 1349
  • Domain: ABC transporter
  • Gene: CFTR
KILLLDE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 1365
  • Domain: ABC transporter
LLDEPSAHLDP3.6.3.49;Channel-conductance-controlling ATPase. 1368
  • Domain: ABC transporter
  • Gene: CFTR
TYQIIRR3.6.3.49;Channel-conductance-controlling ATPase. 1380
  • Domain: ABC transporter
  • Gene: CFTR
AFADCTVIL3.6.3.49;Channel-conductance-controlling ATPase. 1391
  • Domain: ABC transporter
  • Gene: CFTR
EHRIEAML3.6.3.49;Channel-conductance-controlling ATPase. 1401
  • Domain: ABC transporter
  • Gene: CFTR
LECQQFLVIE3.6.3.49;Channel-conductance-controlling ATPase. 1408
  • Domain: ABC transporter
  • Gene: CFTR
FLVIEENKVRQYDS3.6.3.49;Channel-conductance-controlling ATPase. 1413
  • Domain: ABC transporter
  • Gene: CFTR
SIQKLLNE3.6.3.49;Channel-conductance-controlling ATPase. 1426
  • Domain: ABC transporter
  • Gene: CFTR
SLFRQAIS3.6.3.49;Channel-conductance-controlling ATPase. 1435
  • Domain: ABC transporter
  • Gene: CFTR
QAISPSDR3.6.3.49;Channel-conductance-controlling ATPase. 1439
  • Domain: ABC transporter
  • Gene: CFTR
PQIAALKEETEEEV3.6.3.49;Channel-conductance-controlling ATPase. 1462
  • Gene: CFTR

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MQRSPLEKASVVSKLFFSWTRPILRKGYRQRLELSDIYQIPSVDSADNLSEKLEREWDRELASKKNPKLINALRRCFFWRFMFYGIFLYLGEVTKAVQPL
LLGRIIASYDPDNKEERSIAIYLGIGLCLLFIVRTLLLHPAIFGLHHIGMQMRIAMFSLIYKKTLKLSSRVLDKISIGQLVSLLSNNLNKFDEGLALAHF
VWI
APLQVALLMGLIWELLQASAFCGLGFLIVLALFQAGLGRMMMKYRDQRAGKISERLVITSEMIENIQSVKAYCWEEAMEKMIENLRQTELKLTRKAA
YVRY
FNSSAFFFSGFFVVFLSVLPYALIKGIILRKIFTTISFCIVLRMAVTRQFPWAVQTWYDSLGAINKIQDFLQKQEYKTLEYNLTTTEVVMENVTAF
WEE
GFGELFEKAKQNNNNRKTSNGDDSLFFSNFSLLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMVIMGELEPSEGKIKHSGRISFCSQFSWIMPG
TIK
ENIIFGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTR
ILVTSKMEHLKKADKI
LILHEGSSYFYGTFSELQNLQPDFSSKLMGCDSFDQFSAERRNSILTETLHRFSLEGDAPVSWTETKKQSFKQTGEFGEKRKNS
ILNPI
NSIRKFSIVQKTPLQMNGIEEDSDEPLERRLSLVPDSEQGEAILPRISVISTGPTLQARRRQSVLNLMTHSVNQGQNIHRKTTASTRKVSLAPQA
NL
TELDIYSRRLSQETGLEISEEINEEDLKECFFDDMESIPAVTTWNTYLRYITVHKSLIFVLIWCLVIFLAEVAASLVVLWLLGNTPLQDKGNSTHSRN
N
SYAVIITSTSSYYVFYIYVGVADTLLAMGFFRGLPLVHTLITVSKILHHKMLHSVLQAPMSTLNTLKAGGILNRFSKDIAILDDLLPLTIFDFIQLLLI
VIGAIAVV
AVLQPYIFVATVPVIVAFIMLRAYFLQTSQQLKQLESEGRSPIFTHLVTSLKGLWTLRAFGRQPYFETLFHKALNLHTANWFLYLSTLRWFQ
MRIEMIFVIFFIAVTFISILTTGEGEG
RVGIILTLAMNIMSTLQWAVNSSIDVDSLMRSVSRVFKFIDMPTEGKPTKSTKPYKNGQLSKVMIIENSHVKK
D
DIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLLSAFLRLLNTEGEIQIDGVSWDSITLQQWRKAFGVIPQKVFIFSGTF
RKNLDPYEQWSDQEIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPSAHLDPVTYQIIRRTLKQAFADCTVILC
EHRIEAMLECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL



DME EC Prediction for this protein is: 3.6.3.49
Check another protein