Data Mining for Enzymes Search Utility - DME11

Active, Metal and Binding Site Annotations, as well as gene names and domain attributions
are based on Specific Peptides (SPs) extracted from Swissprot Data


Specific PeptideECFunctionLocation of SP in ProteinPredicted Features
RDLDDLKKEVAMTEHKMS3.6.3.9;Sodium/potassium-exchanging ATPase. 20
  • Gene: AT1A3
RDGPNAL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 64 -
GPNALTPP3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 66 -
LTPPPTTPEW3.6.3.9;Sodium/potassium-exchanging ATPase. 70 -
TPEWVKFC3.6.3.9;Sodium/potassium-exchanging ATPase. 76 -
QLFGGFS3.6.3.9;Sodium/potassium-exchanging ATPase. 85 -
GGFSILLW3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 88 -
LLWIGAILCF3.6.3.9;Sodium/potassium-exchanging ATPase. 93 -
LCFLAYGI3.6.3.9;Sodium/potassium-exchanging ATPase. 100 -
DNLYLGIVL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 118 -
VLAAVVI3.6.3.9;Sodium/potassium-exchanging ATPase. 125 -
AKSSKIM3.6.3.9;Sodium/potassium-exchanging ATPase. 142 -
KSSKIMESF3.6.3.9;Sodium/potassium-exchanging ATPase. 143 -
VPQQALV3.6.3.9;Sodium/potassium-exchanging ATPase. 155 -
VVGDLVE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 176 -
GDRVPAD3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 186 -
PADLRII3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 190 -
PADLRIIS3.6.3.9;Sodium/potassium-exchanging ATPase. 190 -
GCKVDNSSLTGESEPQTRSPD3.6.3.9;Sodium/potassium-exchanging ATPase. 200 -
SSLTGES3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 206 -
NPLETRNI3.6.3.9;Sodium/potassium-exchanging ATPase. 225 -
FFSTNCV3.6.3.9;Sodium/potassium-exchanging ATPase. 234 -
TVMGRIA3.6.3.9;Sodium/potassium-exchanging ATPase. 255 -
GRIATLASG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 258 -
LASGLEVG3.6.3.9;Sodium/potassium-exchanging ATPase. 263 -
TPIAIEIEHF3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 272 -
ITGVAVF3.6.3.9;Sodium/potassium-exchanging ATPase. 285 -
FFILSLIL3.6.3.9;Sodium/potassium-exchanging ATPase. 296 -
LSLILGY3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 299 -
ILGYTWL3.6.3.9;Sodium/potassium-exchanging ATPase. 302 -
AVIFLIGIIVANVPEGLLATVTVCLTLTAKRMA3.6.3.9;Sodium/potassium-exchanging ATPase. 310 -
IIVANVPEGLLATVTV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 317 -
LTAKRMA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 336 -
KNCLVKNLEAV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 344 -
KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWF3.6.3.9;Sodium/potassium-exchanging ATPase. 344
  • Active Site D=Aspartic acid at location 366 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
AVETLGS3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 353 -
DKTGTLT3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 366
  • Active Site D=Aspartic acid at location 366 on the protein
  • Active Site Description: 4-aspartylphosphate intermedia
DNQIHEADTTE3.6.3.9;Sodium/potassium-exchanging ATPase. 384 -
EADTTEDQSG3.6.3.9;Sodium/potassium-exchanging ATPase. 389 -
ADTTEDQSG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 390 -
QSGTSFD3.6.3.9;Sodium/potassium-exchanging ATPase. 396 -
LCNRAVF3.6.3.9;Sodium/potassium-exchanging ATPase. 417 -
VAGDASESALLKCIEL3.6.3.9;Sodium/potassium-exchanging ATPase. 437 -
KVAEIPFN3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 466 -
EIPFNSTNKYQ3.6.3.9;Sodium/potassium-exchanging ATPase. 469 -
PFNSTNK3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 471 -
TNKYQLSIHETEDPNDNRYLLVMKGA3.6.3.9;Sodium/potassium-exchanging ATPase. 475
  • Gene: AT1A3
LVMKGAPER3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 495
  • Binding Site K=Lysine at location 498 on the protein
  • Binding site description: ATP (By similarity).
LVMKGAPERILDRCS3.6.3.9;Sodium/potassium-exchanging ATPase. 495 -
VMKGAPERIL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 496
  • Binding Site K=Lysine at location 498 on the protein
  • Binding site description: ATP (By similarity).
GKEQPLD3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 515 -
GKEQPLDEE3.6.3.9;Sodium/potassium-exchanging ATPase. 515 -
NAYLELGG3.6.3.9;Sodium/potassium-exchanging ATPase. 530 -
LGGLGERVLGFC3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 535 -
SMIDPPR3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 580 -
SMIDPPRAAVPDAV3.6.3.9;Sodium/potassium-exchanging ATPase. 580 -
KCRSAGIKV3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 595 -
MVTGDHPITAKAIAKGVGIIS3.6.3.9;Sodium/potassium-exchanging ATPase. 605 -
TGDHPITA3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 607 -
VGIISEG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 621 -
PVSQVNPR3.6.3.9;Sodium/potassium-exchanging ATPase. 641 -
VNPRDAKA3.6.3.9;Sodium/potassium-exchanging ATPase. 645 -
HGTDLKD3.6.3.9;Sodium/potassium-exchanging ATPase. 656 -
HTEIVFARTSPQQKL3.6.3.9;Sodium/potassium-exchanging ATPase. 675 -
VFARTSPQQKL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 679 -
VAVTGDGVNDSPALKKADIG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 702
  • Metal Site D=Aspartic acid at location 707 on the protein
  • Metal Site Description: Magnesium (By similarity).
ADIGVAMG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 718 -
GSDVSKQAADMILLDDNFASIVTGVEEGR3.6.3.9;Sodium/potassium-exchanging ATPase. 728 -
AADMILLDDNF3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 735 -
DDNFASI3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 742 -
SIVTGVEEGRLIFDNLKK3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 747 -
YTLTSNIPEI3.6.3.9;Sodium/potassium-exchanging ATPase. 768 -
IPLPLGT3.6.3.9;Sodium/potassium-exchanging ATPase. 788 -
TILCIDLGTD3.6.3.9;Sodium/potassium-exchanging ATPase. 796 -
PAISLAYE3.6.3.9;Sodium/potassium-exchanging ATPase. 808 -
ESDIMKR3.6.3.9;Sodium/potassium-exchanging ATPase. 818 -
DKLVNERLIS3.6.3.9;Sodium/potassium-exchanging ATPase. 832 -
AYGQIGMIQALGGFF3.6.3.9;Sodium/potassium-exchanging ATPase. 843 -
AENGFLP3.6.3.9;Sodium/potassium-exchanging ATPase. 864 -
LVGIRLNWDDR3.6.3.9;Sodium/potassium-exchanging ATPase. 873
  • Gene: AT1A3
NDLEDSYGQ3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 886 -
EDSYGQQWT3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 889 -
WTYEQRK3.6.3.9;Sodium/potassium-exchanging ATPase. 896 -
VEFTCHT3.6.3.9;Sodium/potassium-exchanging ATPase. 904 -
TCHTAFF3.6.3.9;Sodium/potassium-exchanging ATPase. 907 -
IVVVQWADL3.6.3.9;Sodium/potassium-exchanging ATPase. 916 -
VQWADLII3.6.3.9;Sodium/potassium-exchanging ATPase. 919 -
ICKTRRNS3.6.3.9;Sodium/potassium-exchanging ATPase. 926 -
KTRRNSVFQQG3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 928 -
FQQGMKN3.6.3.9;Sodium/potassium-exchanging ATPase. 935 -
QGMKNKILIFGL3.6.3.9;Sodium/potassium-exchanging ATPase. 937 -
ETALAAFL3.6.3.9;Sodium/potassium-exchanging ATPase. 951 -
VALRMYP3.6.3.9;Sodium/potassium-exchanging ATPase. 966 -
LRMYPLK3.6.3.9;Sodium/potassium-exchanging ATPase. 968 -
WWFCAFPYS3.6.3.9;Sodium/potassium-exchanging ATPase. 977 -
LIFVYDE3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 987 -
YDEIRKL3.6.3;Acting on acid anhydrides; catalyzing transmembrane movement 991 -

Mapping of the Specific Peptides in the Protein

Red characters denote the location of the Specific Peptide Matches


---------+---------+---------+---------+---------+---------+---------+---------+---------+---------+
MGDKKDDKDSPKKNKGKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAIL
CFLAYGI
QAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHG
CKVDNSSLTGESEPQTRSPD
CTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILS
LILGYTWL
EAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTS
FD
KSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGA
PERILDRCS
TILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAG
IKV
IMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGA
I
VAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCI
DLGTD
MVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQ
RK
VVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILR
RNPGGWVEKETYY



DME EC Prediction for this protein is: 3.6.3.9
Check another protein